PBANKA_103520 (SR, lap1, Lap1)
LCCL domain-containing protein, a
gene from Plasmodium berghei
Compiled localisation
apical during sporozoite
surface during macrogamete and sporozoite
during not late oocyst and not microgamete and not microgametocyte and not sporozoite and ookinete
perinuclear during blood stages and gametocyte
cytoplasm during early retort and macrogamete and macrogametocyte and zygote
crystalloid during ookinete
not food vacuole and not mitochondrion during ookinete
Who localised this protein by microscopy?
Carter, V., Shimizu, S., Arai, M., Dessens, J. T. PbSR is synthesized in macrogametocytes and involved in formation of the malaria crystalloids. (2008 Jun, Mol Microbiol)
PubMed /
full text
   more detail about this publication
cytoplasm during macrogamete and macrogametocyte, crystalloid during ookinete, not food vacuole and not mitochondrion during ookinete
-
"Here, using fluorescent protein tagging and targeted gene disruption, we show that PbSR is synthesized in macrogametocytes, gets targeted to the crystalloids of developing ookinetes and is involved in crystalloid formation."
-
Microscopy type: Light
-
Microscopy method: GFP tag, RFP tag
-
Strain:
-
Gene model mapping comments: blast from AY034780, annotation doesn't match
-
Localisation record: cytoplasm during female gametocyte and macrogamete, crystalloid and not mitochondria and not lysosome during ookinete
- Other genes localised in this publication:
-
-
"Indeed, immunoelectron microscopy of mCherry/PbSR/EGFP ookinetes exclusively labelled crystalloids (Fig. 4C), while crystalloids of wild-type ookinetes did not label (Fig. 4D), confirming that PbSR localizes to the crystalloid structures."
-
Microscopy type: EM
-
Microscopy method: GFP tag, RFP tag
-
Strain:
-
Gene model mapping comments: inferred from another publication
-
Localisation record: crystalloid during ookinete
- Other genes localised in this publication:
-
Trueman, H. E., Raine, J. D., Florens, L., Dessens, J. T., Mendoza, J., Johnson, J., Waller, C. C., Delrieu, I., Holders, A. A., Langhorne, J., Carucci, D. J., Yates, J. R. 3rd, Sinden, R. E. Functional characterization of an LCCL-lectin domain containing protein family in Plasmodium berghei. (2004 Oct, J Parasitol)
PubMed /
full text
   more detail about this publication
surface during macrogamete and sporozoite, during ookinete, perinuclear during blood stages and gametocyte
-
"We test the hypothesis that these proteins are surface proteins with 1 member of this gene family, lap1, and provide evidence that it is expressed on the surface of Plasmodium berghei sporozoites. "
-
Microscopy type: Light
-
Microscopy method: polyclonal antibody
-
Strain: ANKA clone 233
-
Gene model mapping comments: Taken directly from paper
-
Localisation record: surface during sporozoite, strong surface during female gamete, weak during ookinete, perinuclear during asexual blood stages and gametocyte
- Other genes localised in this publication:
-
Claudianos, C., Dessens, J. T., Trueman, H. E., Arai, M., Mendoza, J., Butcher, G. A., Crompton, T., Sinden, R. E. A malaria scavenger receptor-like protein essential for parasite development. (2002 Sep, Mol Microbiol)
PubMed /
full text
   more detail about this publication
apical during sporozoite
-
"Interestingly, PxSR stain-ing appeared polarized towards the apical end in many sporozoites examined, indicating that the protein may be targeted to the apical secretory organelles"
-
Microscopy type: Light
-
Microscopy method: antibody to epitope
-
Strain:
-
Gene model mapping comments: Blast from AY034780
-
Localisation record: apical during sporozoite
- Other genes localised in this publication:
-
   18452513 (unpublished)
full text
   more detail about this publication
cytoplasm during early retort and zygote, during not late oocyst and not microgamete and not microgametocyte and not sporozoite
-
"Confocal microscopic examination of mCherry/PbSR/EGFP parasites revealed green and red fluorescence throughout the cytoplasm of female gametocytes/macrogametes (Fig. 3A). .. A similar fluorescence pattern was observed in zygotes and early retorts (i.e. immature ookinetes) (data not shown)"
-
Microscopy type: Light
-
Microscopy method: GFP tag, RFP tag
-
Strain:
-
Gene model mapping comments: inferred from another publication
-
Localisation record: cytoplasm during zygote and early retort
- Other genes localised in this publication:
-
-
"Asexual stages, male gametocytes, microgametes, late oocysts and sporozoites were negative for both GFP and RFP fluorescence (data not shown)."
-
Microscopy type: Light
-
Microscopy method: GFP tag, RFP tag
-
Strain:
-
Gene model mapping comments: inferred from another publication
-
Localisation record: not during male gametocytes and microgametes and late oocysts and sporozoites
- Other genes localised in this publication:
-
Orthology
OrthoMCL
Part of OrthoMCL group OG4_16110
Localised Genes in this Group
-
PBANKA_103520 (SR, lap1, Lap1): apical during sporozoite, surface during macrogamete and sporozoite, during not late oocyst and not microgamete and not microgametocyte and not sporozoite and ookinete, perinuclear during blood stages and gametocyte, cytoplasm during early retort and macrogamete and macrogametocyte and zygote, crystalloid during ookinete, not food vacuole and not mitochondrion during ookinete
-
PF14_0067 (CCp3): proximal to plasma membrane during mature gametocyte, during gametocyte stage ii and gametocyte stage iii and gametocyte stage iv and gametocyte stage v and not gametocyte stage i and not intraerythrocytic, erythrocyte during gametocyte stage ii, parasite plasma membrane during emerged gametocyte and emerging male gametocyte and female gametocyte, not parasite plasma membrane during male gametocyte, exflagellation centre during gamete, beyond erythrocyte membrane during emerged gametocyte
Other Apicomplexan Genes in this Group
-
PY01071 multidomain scavenger receptor protein PbSR precursor
-
PVX_086080 multidomain scavenger receptor, putative
-
PCHAS_103600 LCCL domain-containing protein CCP3, putative
-
PKH_133990 multidomain scavenger receptor, putative
-
TGME49_063410 scavenger receptor protein SR2
-
TGME49_067410 scavenger receptor protein TgSR1, putative
-
NCLIV_024520 hypothetical protein
-
NCLIV_038770 hypothetical protein
-
cgd2_790 CpCCp3, multidomain extracellular protein with a signal peptide and the following architecture: LH2+LCCL+2xSR+LCCL+pentraxin+2xLCCL
-
Chro.20090 scavenger receptor protein TgSR1 precursor
-
CMU_009600 LCCL domain-containing protein
-
TA09935 hypothetical protein, conserved
-
BBOV_III008930 LCCL domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
There are no non-apicomplexan genes that have manually annotated evidence codes.
Amino Acid Sequence
>PBANKA_103520 LCCL domain-containing protein
MRIYNWVSCGFILLQFFMNVYGKEWCKAKFEYGMSDYAECQKEGDNLTNYMIEIIPAKANNIDLYSDVSIVLSNSQGINT KEIIIGSEKEGLFRKIYSVRKDIDNPEYVHVKLNSKINNNRNWKCKKIKIWKDYKYWTFDCIGILNEEKREATYFLSGNK LYTAYVQTGKDIESGTTGIIDIILLGNNNKRSNTKMLHEGFISGGLKKIKFQASDVGNLENIILINNSYNDPWYCDFVKI KSDDSKIYIFNVKSWIGYPYNNKIKININTNNIDGNAKDIDCHIRANDLIDTTKSLNNNFVLQNKVHIFKVRCPQNCHNS EFSIIEGTSIHPASTSICAAAIYDGSLTESGGEIIVTITKGLNYYYAIDEAYNNLKAIEFSTKGDESDENNFSFYTYHLT SIDDIKSNIRIVDSFGKLSSLGRLEIRVNNKWGAVCKKGPNFEFSEDAAKRACKDLGFPNGIYIKENCSNINEQNYCAGY KYPFNASGILCSGNEQNLLSCNTDDPSYCIDHHDDVIIQCVNQLGNDSIENGTIRLLDSTGSPTSNGIGRLQIYYNGVFG SICSEGWTKETEKIACLELGYHNVKANGFSHHLCSDIAGENLCGHDKERINATNFRCKGDEANLKNCPHETSEDIYCSHE EDIIIGCASAEEEGNDSANSTNISKYGLNKHMMSMEKKKFHPKIELSCFDKISSKAELSKGNVGDIFLVSCPEKCDEDIG VIKGTFVYTFDSYICKAGIHAGVLSSSVTDDMILIITHSRNKFIGTKRNNIESKEFNGESKSFSLSIPTNYIIMEERQNN SKYEDEILKEDNDFYYEHIFKKQNNNEQEKNKTFFEHNMHLEPTFQWLAPSSFAGFNGDENQYINANNLPNEKYIRTLSN FTFIIHFIPNSKGKNKWRTILSHSLCEGISISIDEENELVIEQNCNPHLVKTKFIPKFEHPCHLVLIYNKPNKSISLYIN QKKINLEKMKFDFTLNGDLTIGRSNKQATDYFIGDINFVKIYKYILTEQEIKESYDSVLSNNYLNDGMSGNRDINTKKTQ NKKTKNNRKTIDGRDCITPCKSKTNVNKNVQINTEEFYLNCSDNLLSERFNGKIGAQFLVSCLEDCTNSKYIVKGSNNYY TPDTSICKAVMHSGIMHKTRNTHKSNEHDEDNNKTNNNSFIIKIVEGLTEYKSSRGHYGIVSKPEKQSQLRSFSLFSKKE DDIFTCFTDAAFLFELPIGTTKNIICPENCHKIDKQIFGTNTYSPLSSVCKAAIHAGVISTKGGQIQIVVGKGQQEFKSS TQNNIQSYIAEKQNRSFTFLKRLY
Proteomics
Found in:
Not found in:
Gene-Specific Links for PBANKA_103520
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|