ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_102460 (LISP1)

liver specific protein 1, a gene from Plasmodium berghei

Compiled localisation
parasitophorous vacuole membrane during hepatocyte merozoite

Who localised this protein by microscopy?

Ishino, T., Boisson, B., Orito, Y., Lacroix, C., Bischoff, E., Loussert, C., Janse, C., Menard, R., Yuda, M., Baldacci, P.
LISP1 is important for the egress of Plasmodium berghei parasites from liver cells. (2009 Sep, Cell Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during hepatocyte merozoite
  • "LISP1 is expressed late during parasite development inside hepatocytes and locates at the PV membrane."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: NK54, ANKA
  • Gene model mapping comments: taken directly from paper, wrong gene model?
  • Localisation record: PV membrane during hepatocyte merozoite
  • Comment: 'As shown in Fig. 1D, the two proteins co-localised confirming that LISP1 is present in the PVM and in agreement with the localisation of PY04499 in P. yoelii-infected hepatocytes (Tarun et al., 2008).' However Tarun et al. said PV, not PVM
  • Other genes localised in this publication: circumsporozoite-related antigen

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_102460 liver specific protein 1
MYMKNMKRILAYSLFFLYILRNNVLSKKNREYNLLGNAHKSDNIVNRLQVITEGKYRDVLSEVNKPLLSIIENNESVSLD
ILLSTIKLLDDKNKETDDLSKKKEIEQTIIYIKNAIKNHLGNVENNEENDGNDKNDITKTKSNKSNLMLKLDNYYMKRDL
ENLKKKSNDIALRKNNLGKKFKKFSTSSESLLFGAPGDLNLSDDSVKELNNMVSIKILRQRNYKDNMSFTMESPPETFNK
LVDLYTPLLDFNLDSLEKYKNNEIKYYTDSKSEIFYLLRDNMDLGKFFLKLPISKMPNAKPNDNISESSDADNKIYTYVN
NNLEKDKNAKEYSLGAYNTNPVYTYSRKKKKIPINKKNENSESASRVSHLFQKKMDRTYLNKPQKYYNHQNGLIHKNISN
EYNRQFINSNNENETYYKKDNNNILFEIIIKSHLLTNNDVCKKIIIIKKGDGNDSIENNMSEDARIIYDKDFSKNCIQYS
KKNDELYYVIPLIHFNVPSKSMRCLSCDDYEKHIHNKCPFNENFVHLTYDNKCIVCMPSSAINNCLINSQKVNVDSSKGC
CNCTSHFPPNNKFHIFKYVFPSYKYMHRVRDTHNGNNCNCESFIYFGHGYPNFKVRNMNKHRDKRVYEIIHKQMESKYKL
YNRHSNEYQVGEGTIENDVDECMFFGCIHDEDYNEFDDYNIKTRETIKLSSSIFDPINLKKNNSDYAYDDEETIENVNKE
GYIKNDRKQILDIKNLYENAGNNPENEKNEENRDIVKGSDDSDNYDNEISQEANNIEYFKKLYYDILNNNNDDESDESDE
SDDDDNDYYDGIIDNFYSLRFLYKTRIFTKKKTVINAYIKTNKISADDNKKNILFLFKKLFNNVFKDVRYKIKDSAVSLF
PVITDSSIIGFDVDFGRIQAQYAGCINMLRYSVFDTQNMAIYFITPDKKYILLEDVIKEINEGNENYHYNEDIEENSNKN
NETFDNENGSHSIFENLESELDNEYNKTDQPSTQDKKQEIGDKENAHEPSKDDHSKNNGKGSLVELNKDHEEKHELLDTI
LKEFNNEREKTPAQNELSKVLSKYGDLLSKEDLKEIKNNHKNVDVNKGNEENGNTIEIIIKKSSKDDEVNGKTNDKDNIV
NESNDQSEFITIDQNGCEIINETLRKYMDKYFRVHNIPIHYIENNNISKKEIHITSDIDYDLDTLKSSILAISNTNGKSI
DDFKLFLIPNDIEKYDPNKLEDIPSSIRTANDLYNYIKTMNMKILIASVHDGSGISIEPQIFNYLYESNNDTPYIESALD
VKEGKEDTNIELELNKSQYDDKENLRNSSILEKQELSNALLENEIYDTTKKEIKPDKIMKNGIEDTNLRGKISGCSEDSS
ISSNSTEAKTIENNSYHKDEEETFFENDNQYTTPNNYNKIDIYIDNTDRKINVLNGLIFKNYTLKSFIMDIMNKIIHVPS
NFIDLKSYKKGISPFDIFDCLEYYSYNIKSNIISALFFEKNIKLLDILKNLNSKNEYLLIKNKHSEYCSGVDNLKYIKIP
LTINLKKSKDIYLEFPIFHIDEHYNFVYSKISFMNVPENYTASKLCTAVKNMLNEALEIYELDIIKSLKIYNIIENEWEY
IEDNALVHEIKMDNNYLYTLFIHDTFLTKRYYQAMSNLIIDLSNSNIYIKKLDIYIDYNYEPYTLYNIPIHMSFMNLKYL
LLYHTNAFLSDSFLNEFFFTYNEKYLQNSSANDINNDSIYNPNSGVDDYIYEEDEPEESISIFSFISSCTRNNNKTYNLF
LLNMVNTFYKIKLNSNKMMQPILEDLLKISGKCSNDNIIVEINKSSTKVKNIEVYLGNNSKKIKIKNVPLSLLVWKFVNI
LLKGSFNISIEDPERLYNLFVIVPKDKDATINRDYYISTKPGYTIEKILKVIGTNNLCLIKAYPEKLTHIKNSTYYYEYA
MFSFDLLPKVIDFSNPVGLLSFYVNYKNENKLINITNAPENITPDKLLKTILLDMYSKWQNFPKDEKIKFSLFLNNEEIQ
NIKDYISSGKEAQLRTFVSLDKKHSYSNNKKKFVEIDKIPETNSIKIQEAELKAMQLYDNVLREILSKGNINYNNISATG
YTISINVFDGNAYSPVTIFNIPLSATNKDIIAFLLIKSNHINTKHVVDEFLLLNKESFNLLKTKTIIDQNVVFIGELTGL
IDLDRTNLYLVHKPQFNSLDSIFKNVANKNYDFKSEKITALSISEAKGSIIFNIILNQNKKKVFNVTNIPYNMYIIDLLR
YIVGYQRKWIYKYVDFYIIKGSEKHVLNDHSGIITYGRTVSEIFTLCKKNDPCTFHIELASNKIEDGINNTIGDNIDALV
NRDNNDNQKNNNDTILNELKNKINSEEEDNVDIDLSVLRFEFNAGLYDKNIFGTSTICNIPKSYTVEDVLTHIKNMLKDD
CKIRNAENLELEIKIIYNDTYLTIPKELNIEYVINYYFINTPSIVFVTNNDNDDEPFNIIHLILNNTKIDMKNNVFVKKE
IPLYVKKNNNLENIKLKNIPLSITEDNLITYIINYLTKNSEVINFMRDNTSICIYPECDPVYIHYENSQLSFIASLSYHI
ALRNINYITTIESFENFYGNMSHFEFDFYKYSNFNESNISNYNKTDIKELINFDINIHFPATIRTIRIKNFNINMQMEDL
FAKIFQSITTNSYKWKDLFTFIGNRSKIDIIEEESDKTEQLIATFKDHLNEGHNLTFIYKPDNNDINNYIIPRISYMPAL
INFQTKYISISTEISEFENNVTTMYGFPDYLSPSFMLTLLQYNLFKILGKNYLSIYGCSYDSSLCLSESNLLLKNKRFYD
ENTKNDSSKQAMKFVLKLKKKDSKKVNTINDLVSLELNISCQELKNDEDMEECNDIISSLNASSIFWRNSILGFIANSII
IKDYYNNALTLPYIDYRINEKILIQNILEHINISPYLYKLFELSHIDKKCVSYKKELTNTISHIQCLLSFGLNIYFDIHS
TNELNIYNGFDTKDNKSFNITHIYSFPDLYEHNFAEFYIYNDDKTRLLVKNAYKNMKVSSLLSELSKARCRIQELKYDQI
SSFYKLVYVLDGNKFVDIHPDENVEFIHKLVLKYSQEKFMLKIIKKNHIYNIDIPKNMNLSCYPPLIDLNKNYYQVPISL
QINAETFNKLSDESFPRIIVNNVPANAFIISIKEYLVALFKSYIKSIAENSINANFYEFDIDMLIVIYDSTLNKIHKISS
NALQSLTVSKFFKTYYNASLVFQMEEIEKFPEYIYDNFINNFSKAVIDFSISIF

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_102460

General Sub-Cellular Localisation Links