ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_100630 (SPECT2)

perforin like protein 1, a gene from Plasmodium berghei

Compiled localisation
during not merozoite and not midgut sporozoite and not ookinete and salivary gland sporozoite
microneme and not rhoptry during salivary gland sporozoite

Who localised this protein by microscopy?

Ishino, T., Chinzei, Y., Yuda, M.
A Plasmodium sporozoite protein with a membrane attack complex domain is required for breaching the liver sinusoidal cell layer prior to hepatocyte infection. (2005 Feb, Cell Microbiol) PubMed / full text
   more detail about this publication

during salivary gland sporozoite and not merozoite and not midgut sporozoite and not ookinete, microneme and not rhoptry during salivary gland sporozoite
  • "SPECT2 is specifically expressed in salivary gland sporozoites and localized to micronemes. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: Blast from AB182656.1, inconsistent gene model?
  • Localisation record: during salivary gland sporozoite, not during ookinete, not during midgut sporozoite, not during merozoite
  • Other genes localised in this publication: -
  • "Particles were localized to micronemes (Mn) but not to rhoptries (Rh)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not rhoptry during salivary gland sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21677

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_100630 perforin like protein 1
MKMRNIKKSLPVLFILLCIYQQYFINSLRISVRNNKNHRDENKFNKNMELGTMEKPINILCNDVSCNTENNISFVNQKKK
EIDSDSDLYNMFDDDASTSAGDDEDDYDDYTDDKNAEIKDEEQNEHIDKIDQKKDKKRTFSINKQEEEINENKNKTEKFF
KKYKFNDANSEGDDDESDTDDENLDNSTENSYEENKNPENVIDKHMAVFPGLYFVGIGYDILFGNPLGETDSLSDPGYRA
QIYLLNWEFSNHGIANDLHTLQPINAWIRKENACSRVESINECSSVSEYTKNLSVDVSVSGSYMGFGSFSASTGYKKFIN
EISKRTSKTYFIKSNCIKYTIGLPPYVPWEHTTAYMNAVNILPKEFTGLDGDSECTPDVYEQKKMTKQCKNVQLWIQFFK
TYGTHIIVEAQLGGKITKIINVSNTSVNQMKKDGVSVKAQIQAQFGFASVGGSTSVSSDNSTKNDNSSYDMSEKLVVIGG
NPIKDVTKEENLYEWSKTVSSNPMPIHIKLLPIYKSFDSEELKESYEKAVLYYTRLYGSSPHGTIQKDENDIIKILTAST
TITKIGAPPITAECPHNQVVLFGYVLKQNFWDNTSNLKGYDIEICEAGLNSCTSKQGSTNKYDVSYLYIECGTQAMSFSD
QVITASNTTYNTIKCPNDYTIIFGFGFSSSSGKGVSAMHTHITSCRPGMKSCSLNMGNSNDKNYMYLVCVDATIWSGINE
LTIVAKDDFHGAVNRSKQFNDGELVLSCQENGTILTGFTGETHTSSPYVKSPFSKCLKSLKSCSVHGSGQSIGYTNYKSL
FSIILCKNGE

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_100630

General Sub-Cellular Localisation Links