ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_100340 ()

lysine decarboxylase, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_100340 lysine decarboxylase, putative
MDSPNNAMVCGEDNTMYGNNMFENRNIENDYMNTNNSTMGVDTESGVYLDKEGKNPFYIYPYNLKQNRSAILKMMRRKNK
YENIDLLEKYININNATNVCSLRIKLWEALMLYVNKVNVELIYFIINCLEEIEVYWGEEAKNTLQDIISLINDKKYKEVS
NKIGEVLSSLSVTSGKINDDSPFFYTLIVSGKREEYCNNNLNINNNNISMNANNNYNSNNNSGNYFNSDLSYELNKFLQY
EQNRFSNQNNNKKLEYKIVEVNNAKEALLACLINPQILSVVLVDNLIIDDETKNDSNNNNNIFFNFNENSSLNKNYLMNY
NIPNNFKVKQNMCCSNIMNKGVLSCGASNNDHIKTSEKKSRNSRDDINSNDDETTSINCINRDENRNDDRNSSSSGWNSI
QNNIPNTGDKNLKRNRIFLKNDYKFDIGDFVLGYDQLVSAPLEKMKKGYNSLVILIKSIAYIRSSVDIFCVCTSITLDKL
RSVNNKIIRIFTTHDDHSDLHESILDGVKKKIKTPFFNALKLYAERPIGVFHALAISKGNSVRRSRWIQSLLDFYGVNLF
KAESSATCGGLDSLLDPHGSLKEAQIMAARAYGSKYCFFVTNGTSSSNKIVMQALVKPGDIILVDRACHKSHHYGFVLFQ
ALPCYLDPYPVSRYGIYGAIPIYVIKKTLLEYRNSNKLHLVKMIILTNCTFDGIVYNVKRVIEECLAIKPDLIFLFDEAW
FAYACFHPILKFRTAMTVAEKMRSKEQKKLYYKIHNRLLKKFGNVKSLNDVPSDTLLKTRLYPNPTEYKVRVYATQSIHK
SLTSLRQGSVILISDDNFESDAYTPFKEAYYTHMSTSPNYQILATLDAGRAQMELEGYGLVEKQVEAAFLIRRELSEDPM
ISRYFRILNEDDLIPDSLRQCCIAYMNGGNTSTRSGKKKHIRRKKIKKGKQNRDEEKENDNERKQYDEINIQKQFFMDHD
SYSSRYNSANASYSCISSKHAKGGISEPFGNTKYNAHSNNSNNIPSFECINQGYSGSIYVKKTLGNNAYASNDLPTDTII
ANRNNGENETNNIKKYNYKNDERSINGADTINCTSNFENDQYIDRKMRNEVEKKCYEDNATKKMNKKKNKKNESYKDINS
ITNDSSSSFGANDVKCVCVDCMKSENIDEVNDEIRSRCCNSESSGDCDESDIYDKDKLCSKSNSINNFLEYFECSWLSED
EFVLDPTRITLFTGYSGIDGDTFKVKWLMDKYGIQINKTSINSVLFQTNIGTTGSSCLFLKSCLSLISQELDQKKALFNE
RDLNQFNENVYNLVYNYIELSQFSDFHPLFKKKYRNMDGKNNNIFNKEGDLRKAFYLAYEEDYVEYILLADLKERVKHNG
MVVSASFIIPYPPGFPVLVPGQIVSHEILDYLSGLSVKEIHGYDENIGFRCFYNFILNYFDNSIISDPYGYYQKIDKKLY
DKLKRESLRQEKQKNIENSYYIYVYDNKKNKMKKLYLYNGNTVSSDKSIIADNFMDDEGTNYSIVCSDANNGTVFLNNNT
PSLINTNNMRKNTNINSKNINNSPTSEIPYHDNDEDMHKGDNKNLNTIPSNCIYMKNKMNNEQECLCKTGLNSNVEKNYD
EKNIDSIHFRKNMGNDKSSPKNNVHKMHPVNEKKKTYGHILKKNSNKKYILKGKEMKRYYCLSNEKKNNKYNILLTKMKN
NDSEIPKNEMCLNNNSFTNIQNHHFDHKTNHLIRKNYFHDNTYNKSEQNNKNFDVSVNMKREDHYGVNADNNNNENDCHN
NITLGNTPKNIETDNIHYSRTSISNNEDSKNTENEENNAKSEFASVQNTSTNIKCCINNRNTSCLANGSKENFNKMCEYM
QGNYQNTNANSLLDIHYMKKNSKFNKSDDGKYKKKNNSHCLNKKMNTSNIIMSMKTTKKDLLIEYRNCLNGKDEKLNNDR
VLNNYVRNSEREKTNYSDYSNSNKRLNKIIYGKSDGENIQKEMNNVTNENSYEPNNKLLNKDNICFNRREENYNNDNENN
NEKENYDIVSTNCVTKDMQELNEGNVNPNNYSSGNRTDSVMNIEKLNCHNNCCSEKSGRKNSQEICRKMIEENDENNADR
GNKNSVRKMNICDCSNNEETENNRNCNNIKCGQNNLNQSNTLCCKQDDEYKNEDDSSNEGYVNINNVHIKSEIKFCVNNF
HLNENDIQVSPIIVEKDIDKNPNRKLNTLNNNSYINNLITNVDDDTFIHKEGNFFLECALTHSEINCSSFEMDIPLNNVY
YNGDNNDTKECRNYEGDKQTNF

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_100340

General Sub-Cellular Localisation Links