ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_093960 ()

MIF4G domain protein, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_093960 MIF4G domain protein, putative
MLNTLLNIASSYSSSECKEKTILNNKVCFKETYNKEEEDNRKKSANNFNINNTNNNICESKFQANNNENNNNNNNSSSII
PNSIKNNLARNFNYNNMQNRQFEKSSNSAKCMAYNFQAKEVNNTIGNDTNNNNSSNNGSKNNSSSSNNNNNCDDNTNKNE
ALNKFEKKENDTIMNMSLPGKNDVVDFEKGSDNNNNSNDNFTINSNRSNNIGDLKKSEHVNNSQDNDNNFIKNHNPVNNS
TFKIQGTSSTCNVNETLPIIAVNNTSSFLHKGDNNNNSNCSSNCEIISEMDYSQCTVKNAFCVVNPSHILPKSCNDYNKI
EISDEKCDNVNNNSHIIQESKITQISGITKINESTVHDKINNCTTSNNNAAENNDNKNSYGNSSGNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNKGGSENRPGNNSNTGNSNGGGNGTDPDGNDNKDDNNENDKDKNNSSNANDNNNNNNNDKIKK
KENNNKNGDSNVKKTSKNVNGNDNIETKKLNTKSLISNTNSSSTISGSSLNADAPEFVPSTKSVQGNLQFNNLMWGNYYH
DIPNNSFGNMQNVNLLNMNGLGNNNNIMIQTSLIDNITNINNDAAGNNLLGIQNSSNNNNNNNNPGTVIDSNLNAYNNKT
GGIAGSNSVVNKNNTNAGNTNTPLGGQFNGVDGNEKFTDKNNNNLIPISGNNSKVNSNNIHSVNTEDNNNTTGLGNKNLG
GTRPLDSAYLNHNMLEGGKNSRPNNFMNNSENSNGFDNTDMHNTSNNNNNNNNAHQNFPGNNSMMHHHPHHHNFYLNPPY
LINSHPNGLSGHQTIFTPIPYGGGGVAGTNNGDIHHELPFPQPPVYNHFGNNSMNVQKNGNLNMNPYNFISCGLPGAGPL
GTGGPINMASHHHIDPHFLNNTDNVPMKLPYNHMSQTNRRNNMFGHFGNNVNLHGPNNINDNNYDINSNNSNINPLLSAN
IGGPGYVFNSSYNTMQAGVMRLNTDGNTSTNSNNTSNNTNTNTVNSNSPSNGNNNNNSLNITGNVIAINPPIINPGVNVP
IPHHHIDNINNSMHINGIHMNHGLLLNNANMNNMHSMSNHVPMGNVGNMGSGIVGLVGLGGIGGMNTTGNISKQQKRQNG
YNDRTGGMNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNNTENVGTNNNNNTTS
GSANNKQYNNNYKENKNTMKNNIGNGNEVLNSYNYGMKHENNKKNNSRYNLMNNTGDNFNTNYNYNGSNTMKNNSATAKG
SYNNKGGKEESNSITGGNNFYNRNGGNTSTTGGGSITSTIGNTTNNVNTSNDNTKESGPSGDATKEVVSDLNESNNTKTN
NNKDNLQYGNYKGKNNYYLNSSNDKNSKGHNNTIANQNGVTTSNNKDDYKSGRNYGSNKIVDDKNGGSASKKDAGKDNTN
NNNNSGRYGKQGDNWIKKGYGANNSNTSNNINSRINNSTTKHGSYSNSKYSTGSDRRSSNNRYDEGANKTEKLGYKTNDK
KGKSEEDKHTKENKINNSNNAGINNNQTNEAGNKNSNTNPSNEENNTTGYNANNKVGYNNLKNVKNGDKKNMEFSSWVKI
AKMNPNNKKKNEKINLPSSQPDNTNPAASSSSSVKNGNTEDTNHNYSNSRNYNKGSGYGKGFHGEVPQVNEENETPLLPT
NKESKKNTEIKEDAKKESHILNSTTHTNQRYDSHNKGLKKSGGVDDKIKGKAIGNYFGNKNYINEEVRNKDSNRSKVVDN
KNKNSNSNNNSNSVSNNGNKIIDYNDKKNLSNNLSGNNNSYSHRQREKLKIKNVEIKQIGEKIVPNFSSASARNSSSGHN
RGMKYNENEDKNDVEKNKKNSTHSSDNNINQKKETEEITKDEIKQTANKNDKNYVDEENADNKDLVKKNESNNVNSNVNK
NKEIGKDEVQINSQTNNLDDNTKGKKSNIFNQTKSSYKYSTEGENNPNTNTSNENNNKTGSSNYKGSLWNGKISFAEMAK
RRPKKDSKEISKEWTGNNNKPGQTEKKGSNLNKNGKVLRRTDDSHMKQEQTDHVTYDNKSEINEEELTKEDDKDEIKRED
EIENVEREETEEKKNKEIDSNNNDDDIEIFNELANEEKEIISTSNKDAGNRETEELGGIKNKINKIEIEEKEIKQNKLAS
KDVSQNKINIDDNKITMNASEDEKKKMGKDEIIAKTNNDEKSVENKLNNKEKEKEKTEELNSVKSKKNDDETENKEKNDN
KNTESEERNDKNILDIDNDKLNDENKNVLDPKQKEKQKKIEKWQSEKRFTKIDLLEIYLGHNWSLRGENFNFVLSKDNTT
DTHYKGNNYIHNNINSNEDNNNNNNNNNSNTSNIYMNDGKVSNTYNNKRYNNSGYNHGNNMNNSQLNQYSIHNSGNNIGN
NSNNIGGNNNNYEKNMQSNQNSNNGKGGDDGWRHSYSKNMQNSMHINGGNNNINYMNGNHNDPNSLNINNNIGNNHGGKN
GQGNTFEWRKGDGDKLKGFFDSTRAVESPDAWRNNNTGQQNGNGNNSKPTISENSWLVKQSQLKADKYTCLMRKLRGILN
KLTFEKFDLLYEQIILVDISKLEEIIGLMKLVFEKAVTQHHFVQMYVQLCKKLNIHFHSMKLEDGSVVQFKKILINQCQD
SFENNLKPIEFPSHLNDDEKFEFEQMHKNKVRGNMLFVGELVKSGIISIPIVFVCINQLLEKRDSYISQKNDTNEGNLHL
EALCMFLNTVGEILDTHEKSNQEEVKNLYNKLNEIVNDESILFRVRCLIKDVIDNRNEKWNKKFAHKLEGPTTLSVLHDK
ILKETIDQNNRIFSTNNSNNYHENKMNSSLNNMRNNLLRNSNYGMNNNSGSGGMGNNNNNNMPFGMNNQMNMRGMGNTGM
KNMDPNKNMKKMTMNIMKNKNTSSKMMPDDMKFGQNSGTHFGDGTGPFVTDNTSGGNYYENTSKNNMPYKNQPFMGNDNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNSGTGGSSSSSLNNNTNSNNGIFSNLSSMFTNKENKNEGNFFSRVFNLKKNQNNNNSGPGQDLPFRGDVDGNINKTN
ENKINGNENKANANNNMSNNISNVNENGQNDYSYVEDYLPKINEIMELSTNVNEWDELTKKFEELNIPSKYNEKLQNTIL
KLTLKKYACNKYLERSESYFNWLITIVLANKIDSVSFKSCWKSFFLENDENSYEYTKEDYPLLPFIAKNFIKAVEQHDTD
HILYDIDALNEIKNVV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_093960

General Sub-Cellular Localisation Links