ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_093850 ()

succinyl-CoA synthetase alpha subunit, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_093850 succinyl-CoA synthetase alpha subunit, putative
MKYSNIKNLCFPLKGRNYSATSKVFIDKNTTVICQGLTGKQGSFHTTEALKYGTKMVGGVNPSKKGSTWTSIDNKYTLPV
FGSVFEAKEKTNCYASVIYVPHQHAKNAIIESIESEIPLIVCITEGICQHDMLEVKACLNMSKKSRLIGPNCPGIIKPGE
SKIGILPSHIHKKGCVGIVSRSGTLTYEGVNQTTKVGLGQSTCIGIGGDPFHGTSFIDCLKLFLEDDETKCILLIGEIGG
NAEEQVAEWLIENNVDDPEKKKKKKNIFAFIAGRCAPPGKRMGHAGALISGGKGTADGKIEALRNAGVHVVINPTKIGEE
IYNVMKDII

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_093850

General Sub-Cellular Localisation Links