ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_093350 (ROM1)

rhomboid 1, a gene from Plasmodium berghei

Compiled localisation
surface during after sporozoite invasion of hepatocyte
apical during merozoite

Who localised this protein by microscopy?

Srinivasan, P., Coppens, I., Jacobs-Lorena, M.
Distinct roles of Plasmodium rhomboid 1 in parasite development and malaria pathogenesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

surface during after sporozoite invasion of hepatocyte, apical during merozoite
  • "PbROM1 localizes to the surface of sporozoites after salivary gland invasion. In blood stage merozoites, PbROM1 localizes to the apical end where proteins involved in invasion are also present."
  • Microscopy type: Light and Electron
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from CB603492
  • Localisation record: surface during after sporozoite invasion, apical during merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_093350 rhomboid 1
MSNIHTLAEYRDGYGENLPFNRTPGYYASQSSFIQRSKPIDVVNLIFPNFTWKSFVMVVSIIQIIVFIISLSISPGEFLT
PSGSILVTLGANVGSKIKNGEIHRLILPIFLHANIFHTFFNVFFQLRMGFTLEKNYGILKVAILYFVSGIYGNILSSSVT
YCTIKVGASTSGMGILGIVASELILLWHIIRHRERVVFNILFFTLISILYYFTFNGSNIDHIGHLGGLLSGISIGMLYNE
KMENKPTWYNNVKIASYACLVLLAIVPTVVLFAVPRAC

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_093350

General Sub-Cellular Localisation Links