ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_092670 (EXP-1, EXP1)

circumsporozoite-related antigen, a gene from Plasmodium berghei

Compiled localisation
parasitophorous vacuole membrane during cytomere and early liver schizont and hepatic and liver trophozoite and merozoite and merozome and schizont
surface

Who localised this protein by microscopy?

Rennenberg, A., Lehmann, C., Heitmann, A., Witt, T., Hansen, G., Nagarajan, K., Deschermeier, C., Turk, V., Hilgenfeld, R., Heussler, V. T.
Exoerythrocytic Plasmodium parasites secrete a cysteine protease inhibitor involved in sporozoite invasion and capable of blocking cell death of host hepatocytes. (2010 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during early liver schizont and liver trophozoite

Putrianti, E. D., Schmidt-Christensen, A., Arnold, I., Heussler, V. T., Matuschewski, K., Silvie, O.
The Plasmodium serine-type SERA proteases display distinct expression patterns and non-essential in vivo roles during life cycle progression of the malaria parasite. (2010 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during cytomere and merozoite and schizont
  • "As a marker for the PVM, we used chicken anti-EXP1 antibodies (green), and DNA was labeled with DAPI (blue)."
  • Microscopy type: Light
  • Microscopy method: chicken antibody
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during schizont and cytomere and merozoite
  • Other genes localised in this publication: serine repeat antigen 1, serine repeat antigen 2

Ishino, T., Boisson, B., Orito, Y., Lacroix, C., Bischoff, E., Loussert, C., Janse, C., Menard, R., Yuda, M., Baldacci, P.
LISP1 is important for the egress of Plasmodium berghei parasites from liver cells. (2009 Sep, Cell Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during hepatic
  • "To better define the localization of LISP1, IFA was performed with anti-LISP1 and anti-EXP1 antibodies. As shown in Fig. 1D, the two proteins colocalized confirming that LISP1 is present in the PVM and in agreement with the localization of PY04499 in P. yoelii-infected hepatocytes (Tarun et al., 2008)."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV membrane during hepatocyte
  • Other genes localised in this publication: liver specific protein 1

Sturm, A., Amino, R., van de Sand, C., Regen, T., Retzlaff, S., Rennenberg, A., Krueger, A., Pollok, J. M., Menard, R., Heussler, V. T.
Manipulation of host hepatocytes by the malaria parasite for delivery into liver sinusoids. (2006 Sep 1, Science) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during merozome
  • "The pattern of immunofluorescence staining (3) with polyclonal antibodies specific for the exported protein 1 (Exp1), a parasite protein that becomes inserted into the parasitophorous vacuole membrane (PVM), indicated disruption of the PVM (Fig. 1E) and liberation of merozoites into the host cell cytoplasm."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during merozome
  • Other genes localised in this publication: -

Tan, T. M., Goh, K. L., Binh, L. N., Ting, R. C., Kara, U. A.
Identification of a Plasmodium berghei antigen sharing common features with P. falciparum and P. chabaudi parasitophorous-vacuole membrane antigens. (1996, Parasitol Res) PubMed / full text
   more detail about this publication

surface
  • "This antigen is localized on the surface of the parasite and shares peptide sequence homology with the P. chabudi antigen Ag3008."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: VAN
  • Gene model mapping comments: homology to PF11_0224, annotation matches
  • Localisation record: parasite surface
  • Comment: The original citation for this protein, but more details have emerged regarding its specific localisation
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48217

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_091700 circumsporozoite-protein related antigen, putative
  • PCHAS_091760 circumsporozoite-related antigen
  • PKH_091900 circumsporozoite-related antigen, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_092670 circumsporozoite-related antigen
MKINIASILFIIFSLCLVNNAYGKNKHGKTGSKNVIKKPAEPVIDVQELISDMVKKEEEIVKLAKNKKSLRKANVALATA
LSVVSALLLGGAGLVMYNTEKGRHPFQIGKSERGTSEDSKPTNSPVDDESSLGFSSEGIQNFASTAREAMLKDDIATPLN
MPNLQQ

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_092670

General Sub-Cellular Localisation Links