PBANKA_091740 (PF16)
PF16 protein, putative, a
gene from Plasmodium berghei
Compiled localisation
cytoplasm during before gametogenesis
cytoplasmic axonemes during 10 minutes after gamete activation and 5 minutes after gamete activation and after gamete emergence
during not macrogamete and not ookinete 24 hours after activation and not ookinete 4 hours after activation
Who localised this protein by microscopy?
Straschil, U., Talman, A. M., Ferguson, D. J., Bunting, K. A., Xu, Z., Bailes, E., Sinden, R. E., Holder, A. A., Smith, E. F., Coates, J. C., Rita, T. e. w. a. r. i. The Armadillo repeat protein PF16 is essential for flagellar structure and function in Plasmodium male gametes. (2010, PLoS One)
PubMed /
full text
   more detail about this publication
cytoplasm during before gametogenesis, cytoplasmic axonemes during 10 minutes after gamete activation and 5 minutes after gamete activation and after gamete emergence, during not macrogamete and not ookinete 24 hours after activation and not ookinete 4 hours after activation
-
"Before the onset of gametogenesis, PbPF16-GFP appeared as diffuse cytoplasmic fluorescence (Figure 2). At 5 and 10 minutes after activation, more intense PbPF16 was seen associated with growing cytoplasmic axonemes (detected by ?-tubulin immunostaining; (Figure 2). Later, when male gametes were emerging from the residual body of the male gametocyte, PbPF16-GFP was clearly localised to the emerging male gamete and had patchy distribution along the length of the gamete; moreover it appeared that PbPF16-GFP was always encompassed within the axonemal fluorescence (Figure 2). The protein was not detected in activated female gametes or in the ookinete at either 4 hours or 24 hours after activation."
-
Microscopy type: Live Light
-
Microscopy method: GFP tag
-
Strain: ANKA
-
Gene model mapping comments: taken directly from publication
-
Localisation record: diffuse cytoplasmic during before gametogenesis, cytoplasmic axonemes during 5 minutes after gamete activation, cytoplasmic axonemes during 10 minutes after gamete activation, axonemal during after gamete emergence, not during female gametes, not during ookinete 4 hours after activation, not during ookinete 24 hours after activation
- Other genes localised in this publication:
-
Orthology
OrthoMCL
This gene does not have an OrthoMCL group.
Amino Acid Sequence
>PBANKA_091740 PF16 protein, putative
MSKVIHQIFDDYNKSRIQFTQSVSDLCLKPHNIEILINTDIINLLRPLILDKVPIVQQNATVILAKLASYSEEVALTILQ NDVLPHLIYCLKHENKNYRKNCAYTLKCLANHNSKLANIVAEGNCIDYLMDCLDEYDLRVKQSCINALCAIIKNDLELSN NVVDKGIIPLLILCLQEKDNNLIKSSLNMLSELCKQSDEIAKNVVDNNVLPNLIKFLDNNDNYIKKNACNCLSQIAKHKE ELTELMIENDIFPKILYLLKDNDDIVKKNCANCLKEMSKHNEDICKIIVRAGALPLLCECIEQSSKDTIKLPAILCLGFI SSFSESLSLNIILSNTIPILKKSMIEETEDYIKSACVWAVGNIGKHSTEHAKKLADENILIILVNLYNSNESSDDLKKKV KIALKGIIQKVTDLEALHPVFLKSPLKLAKYSIFQFSKILPKNPSYKKSFIKSGCLKYLQEIKNCEDSKKFELEISSINN SFPEDIINYYTPGYSETLIKKIDEVEKNE
Proteomics
Found in:
Not found in:
Gene-Specific Links for PBANKA_091740
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|