ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_091570 ()

mitochondrial ribosomal protein L2 precursor, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_091570 mitochondrial ribosomal protein L2 precursor, putative
MNKGLIDKLKNSPLFKRYFSNLYSYNIKKNVPEYIDFETFFPKREIKPDVLSPFTMSKQQRIEKLLEDNPLVLYKGRVIK
KLSCPKIKHSGRNDVGKITTRHRGGGHAQRLRFIDFKRSRKDIYSTVLRIEYDPTRSAHIALIQYEDGVLSYILAPLLLR
PGDKVIASRYANIHPGNALPLKNIPVGSLIHNIEMRPGAGGQLIRAAGTYATVLSKDSLYATIKLKSTEIRKFPLECWAT
IGQVANLERHMRILGKAGVNRWLGKRPVVRGVAMNPSKHPHGGGTSKKHTKRPKCSLWGKCRDGFKTRSKKKPLGLIIRR
NICGRLQKKYGVTT

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_091570

General Sub-Cellular Localisation Links