ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_091560 (AQP)

aquaglyceroporin, a gene from Plasmodium berghei

Compiled localisation
plasma membrane during ring and schizont

Who localised this protein by microscopy?

Promeneur, D., Liu, Y., Maciel, J., Agre, P., King, L. S., Kumar, N.
Aquaglyceroporin PbAQP during intraerythrocytic development of the malaria parasite Plasmodium berghei. (2007 Feb 13, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

plasma membrane during ring and schizont
  • "In P. berghei, PbAQP was localized to the parasite plasma membrane."
  • Microscopy type: Light
  • Microscopy method: Epitope-specific antibody
  • Strain:
  • Gene model mapping comments: Blast from XM_671432
  • Localisation record: parasite plasma membrane during ring and schizont
  • Comment: GenBank also blasts perfectly to PB300862.00.0. Both genes are on short contigs.
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_091560 aquaglyceroporin
MKVTFGNEYIKNFLGEFIGTFVLMFLGEGTTANHFAVPIKNDWLRLCIGWGLGVFFGILISAKLSGAHLNLAVTVGLSTI
KKFNYKQIPLYFAGQLLGALSATASVYGLYYGFVSDQTIPKFSWETGKHANVHIASAFMHEFILTGILLLIILSVTDENI
CGKFHVLKVSSIVGLAIICIGISFGGNTGFALNPSRDLGARILSAIAYGFEAFTRDKCYFWIPLIAPIIGSIIFCQIYDK
IVAPLVVISEHDKGALEI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_091560

General Sub-Cellular Localisation Links