ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_091440 ()

heat shock protein hsp70 homologue, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_091440 heat shock protein hsp70 homologue, putative
MASFNKNGLAKIVETCLKRNPLKNKIRELCTSKVNHNRASGDIIGIDLGTTNSCVAIMEGKQGKVIENAEGFRTTPSVVA
FTNDNQRLVGIVAKRQAITNPENTVYATKRFIGRKFDEDATKKEQKNLPYKIVRAPNGDAWIEAQGKKYSPSQIGACVLE
KMKETAENYLGRKVHQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAFGLEKSDGKVIAVYDLGGGTFDV
SILEILGGVFEVKATNGNTSLGGEDFDQRILEYFINEFKKKENIDLKSDKLALQRLREAAETAKIELSSKTQTEINLPFI
TANQTGPKHLQIKLTRAKLEELCHDLLKGTIEPCEKCIKDANIKKDEINEIILVGGMTRMPKVSDTVKEIFQNSPSKSVN
PDEAVALGAAIQGGVLKGEIKDLLLLDVIPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADNQTQVSIKVFQGERE
MACDNKMLGSFDLVGIPPAPRGVPQIEVTFDVDANAIINISAIDKMTNKKQQITIQSSGGLSKEEIEKMVQEAELNREKD
QHKKNLTDSKNEAETLIYSSEKQLDDFKDKISDSDKEELKQKISALREKLTSDNLDSIKDATKQLQEKSWAISQEMYKNN
AQQSSQQEQNTAENKAEENKDNA

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_091440

General Sub-Cellular Localisation Links