ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_091260 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_091260 conserved Plasmodium protein, unknown function
MDDMGKRQEFETNGTTLKNGGVNFYSSITDRISKLKTIIKHKKKSNNTDKQETKKQNEEAQKDNSKNVQNKSILYSNETE
CDNNMKNNSNSENKKKYKNKKEIELLKNIAKRNSLKKIEKNINLLLMSEDEDDDSINDNSVSGNLKKNNDTKNINNMQNE
NYTMNSSYHTNIKKDEERKRFLKKNIENSDAPYNSGNYNETAIHTKLGNSNNVLTAISQSSNKNVNINNSNNNEIYEHET
NRGENSNLIHNDDFDISLVSSDSLKQDFSIYSFNGTNNSNNKYFPNSIDNMNISKISGFSKFKDLETQGHNTFTDSFNCN
SSNNINNSFSKYIQANNKNEKGKIYTNVDNIPESHYIKTINNVGDSSLNQREKRKFIDNSNSNDCNNSFQIYMNDSGITN
KNKNSIINNTVERNYNLSSMNIEHLENSANNQLDNKYMDYPNYKSYIDSMSEEYEKGSLKSYISSENKHSNNNNNINPMS
TFNNSRLDIASFSSSLDARINKFPNDIENGKSISKFHNNVGDNIKGNRLLGAESHLNMSPFLYTNPESIENVENDDRSNK
KRQNKIETIMKNKASNDILNSINRENNRTLSNSKGILLKSFGRREELDEKQSLLKGEDREISLQDNEKKIVSNLENNENF
DSRYNEYEIDQANINEICKKINSISMLNDLSLTKLESLNSSILEAHTKYNGHENFLDDVILNDSIFNHSNMMSKDNKELK
ELNISDSLKHNFFHSMNKLDEDNIFKISKSYIENSLQASKKDILNMNVSKIREKYERHQNKMSNWGMSLNNHDNININNC
DSFSNEKANILNINKNEISDNNNTNFYEEKKIFISESIDKRGLIEQSQINNITKHLYDIKKEENENYNNINDLRSNKSIV
SSKFSYKLDTDILLKDSINFEKNDHINSLRKSNTDIIGYINKFVGSKYVEERNETTQNNTRIGEDTKIEDKSIPILNDSR
NEYNIKNYSIFYGNKENNNKNHENKLSKKESELFNCVASDIYNERKIYENELYLNKDELILNERIFRDKKLEFRKSFEDE
NIPFKNSNHSNDIHNDEEAKWTNYSELDSEEYFKKNKTDASTNSMSDPIVNNMKLEDDIDIGVVGDNITILGKNNSFKGV
NFSNKDYNANYGEIKNGKNDNDKNIDRGIKLKNELNIMTRHASKKENEKREMNETSEVDIIDQRDFMNTNSKSMYERESN
ISCDMNDGNFAKINSKICENDKAENTAYEEPKKLLNNYDDIVKNGKHVNENIFNIFKNNTKLEYNNYNSDTGFSDTGTNK
SYISTTMKFPNVISEKDDKKTNKRKRSFDNTTTLDEKDNMNIIKNSFAQVEHGINNFTEYQIMEICNDSQNGENSGHNGK
SGNNSSRNSICNASYKSNDIKHSNITNMSDVLNLNDNKNTKIIFFDNINNSSEYYDIPKPIHSSIFENESNSYKEDTINN
KYYNQAYQNNHIETIPLNDVKGFIINSSFNDNYIFPNKSLKNHTGTLADPQNINNTIDVANNDLPTNMNTQNESLNNEAI
ENGNRKMIKNRILKLVTENNKFNIEKEINNINGDNSIHNNVNRNDQAYESKKFNTANSINEQKLQHQNVLISKEENPIPD
KQIIEEGVNIRSLTGVRDQKECRQKINAEKDPTIYLPNYEHEISNKCMNKGVSKTPEKSNEIQKEKENIELYNNNFKSFN
KDNKIIPYTHISNEKIKIKNNSANLVSENLKEYPYDNQNIIFGQEIYNNNVVKNGEQIEQTNSFISMKENNYKDEFHTNI
KSLDNIYVYANLNNSKYNSEICNTSGDMKYENYNGIYPKNYNKKDSIYKNRNKFDDKILNKVNRTTDISEHIYIDDTTIP
ALELNNGKILKRSNTCNEDSKSFNNDHINNEINNIVRHQNSRTNNEYLDRHEYQYEMKYKNLNMAYNPHIHNNMSDIIIQ
DIQNDEKKKNTDLEAHCNYRQNCECKHNYYNGKLRNNEYNKKEKKDMSTMTNAIYYNMKQYNNENIEKQKAQNMENNKRD
YNVSNVNDGNFLAYQNANQNYAKSKCVYNEIPYYVIKNVGKDGSENYINNNGIYTGIRDINNLLDTNPINQNDNDRYISY
ERVQNQRIEPNNLDGIDNNLSYDKNGNVNNLIKGCKNINHNERQHSLCLVNYDLEKNINEDEISRKGTICNEVTNHFMKI
NMQNGEYIEKMEYDHHTNCINNVNSKIGNSENTCCKKNQHCNNNINNNYNTHNKILSGYYYNESNAVECKKLPSKILNNL
NQNYDQGNPNKIGTNCFNYNHDNNNACQCVSSNFMLEENKVCNGHFDNNFCSSCDNRNDYGIENNLYYDGEYISQENGKI
IKTQRNPCNHKDQHFNNSVYNQNSHNVDNTLNCRCFREQAQYSENENNENFMKNGKMKYNNFNNDKCDIKNIHDNNKINN
EQKFYEQNNSFQQKCSTCACHTREHYNVEMEVPECNNGNRQNISDNNNKVENNQYAPNGKIYKNNPPCNNSDQMNNKKTY
KTNANPPLLKKTNTNYECHNLKCESWDNNENSNSNIQLDGNKIHNNEAYGYEKILEITDQITTKDKINIRGKETNIYHTD
NNTNKNNNDKINENDADNSDTNKLHTLFREKLGGLETGQNGHVLSQLMNVMINIQNDLKDVKSKLLIKKKNEIENNVKNE
NIVNNDQNREQQNDQTNTKTYDTLKGKERGKMTEESNNDDIFTLKKVEIAINELHRSISSKNTNSQNTECKIKGEREVKM
HSQFIDFEKNNNVVTFSSNKPIRYSSRTNNINRDHDASVKKGDDIDEKKKDGKENKINETIVKKQFSSNINVVLKNLNYE
YIEDSTVSKSNRLYLFNKFFTSLFYEENTKMHNCIMFNIYNIEQKRQTHKVTLFSEKDYYDIFNLAYNNLLFYAFDCYKF
FRYIKYKFRDTYKIYENSTICLYINNCYETNLIKRIFIEQNYIADNIHRSNTQDNTEKTKNKDSKKCEIKIDSIQKKPVS
YTLNEKRILKTSTKYFLDNFLSHINKQINIKNIIPIMKKENYEFDQTNLYFFISNFNLMDKVFSDSHGFDCNKKFFEKNA
SNTKNYGIFFKFVHEATKFFDTFIDDRCNSNKRHNKREENSYTNDRLTSHTNNSDENYNKNNGRNQLSNRGCYRLIIVSL
HKGKTFKYENFPFHNFMKYKNNEIYNYYNNYDSIYFNNGTVILFDLSYAVPFYYIEYYKN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_091260

General Sub-Cellular Localisation Links