ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_090710 (IMC1b)

inner membrane complex protein 1b, a gene from Plasmodium berghei

Compiled localisation
pellicle during ookinete
not parasite plasma membrane and ookinete protrusion during retort
not peripheral of oocyst protrusion during oocyst protrusion
during early oocyst

Who localised this protein by microscopy?

Tremp, A. Z., Khater, E. I., Dessens, J. T.
IMC1b is a putative membrane skeleton protein involved in cell shape, mechanical strength, motility, and infectivity of malaria ookinetes. (2008 Oct 10, J Biol Chem) PubMed / full text
   more detail about this publication

pellicle during ookinete, ookinete protrusion and not parasite plasma membrane during retort, not peripheral of oocyst protrusion during oocyst protrusion, during early oocyst
  • "Here we have generated genetically modified parasites that express IMC1b tagged with green fluorescent protein, and we show that it is targeted exclusively to the pellicle of ookinetes. Very weak cytoplasmic fluorescence was observed in macrogametes and zygotes (data not shown). As the ookinete develops by forming a protrusion of the spherical zygote, a developmental stage called retort, strong fluorescence became localized to the periphery of the protrusion corresponding to the newly forming ookinete but not to the zygote part of the retort (Fig. 3). These observations argue against the targeting of IMC1b to the plasma membrane; in this scenario the protein would be localized to the periphery of entire retort, which is clearly not the case. We also studied the process of ookinete-to-oocyst transformation. This starts with the development of a round protrusion midway along the ookinete, a developmental stage called took. These protrusions were devoid of peripheral fluorescence (Fig. 3), indicating that IMC/SPN are absent from this part of the cell. As the rounding-up process of the ookinete completes, young spherical oocysts form; these displayed peripheral fluorescence only in part of the cell (Fig. 3). However, older multinucleate oocysts no longer displayed any fluorescence (data not shown) indicating loss of the entire IMC/SPN structures, consistent with documented oocyst architecture."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: ANKA clone 234
  • Gene model mapping comments: Blast from EAA15257, annotation matches, agrees with 'single exon, 535 residues long' as suggested in the publication
  • Localisation record: pellicle during ookinete, ookinete protrusion and not PM during retort, not peripheral of oocyst protrusion during oocyst protrusion, during young oocyst
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_090710 inner membrane complex protein 1b
MKIDKNKSASISNHDNEMPNMEKLYDQLSFQKFENESNSSLKYSEIDKISSLNKSTQSFVYSNNTNNSYANTSKSGTRIM
NKPNVHIVEKIKEVPTYIVKNQTRIIDVPELRFVNKIEHDTTHVIEKLKYVPKDVTKYNIIKKPVIKNIVKEKKMDVLHV
QEKISFRDQEVIEEVYNYVDKDGNKIKDHNDIMTMDYNLSNENESNRKIDYPVYPSLNCCNNTSAYIENSNNICSMLCDN
KDENTNIIEKSKRENLPYDVNINMLPPLLEPFGPQIKTEDNKIFENVFVPKVEKIVEVQKKIDIPINLPVPYIVPKPKII
DVDIPVFKFNDKYVPVPVRQKIIPKVTWSDKVYKIDCIIEKPYLVYHDIIKFVPTDTKINIREYPKGINKINPEELYEAD
NLALWMRVNADLKEEKDKLKKNTQSDSMLDHICECSDCETCEHISNSELNISHDLSNIKYSPNNFYDTIPLHQDHPLEMV
HLQNKWMKKDTTKIPELYNEQFMNAHRNAFFNLTSKIPREAKVEMKTISQLKTNT

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_090710

General Sub-Cellular Localisation Links