ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_090130 (MAEBL)

merozoite adhesive erythrocytic binding protein, a gene from Plasmodium berghei

Compiled localisation
microneme during oocyst sporozoite
during not merozoite and not salivary gland sporozoite and not schizont

Who localised this protein by microscopy?

Kariu, T., Yuda, M., Yano, K., Chinzei, Y.
MAEBL is essential for malarial sporozoite infection of the mosquito salivary gland. (2002 May 20, J Exp Med) PubMed / full text
   more detail about this publication

microneme during oocyst sporozoite, during not merozoite and not salivary gland sporozoite and not schizont
  • "We found MAEBL of the rodent malaria parasite, Plasmodium berghei, to be specifically produced by the sporozoites in the oocyst and localized in their micronemes, which are secretory organelles involved in malarial parasite invasion into the host cell. Stage-specific production of PbMAEBL and localization in the microneme. (A) PbMAEBL is specifically produced by sporozoites in the oocyst. Immunofluorescent staining was performed in sporozoites collected from the midgut (left), sporozoites collected from the salivary glands (middle), and schizonts (right). Merozoites were not stained by either antibody (Fig. 1 A, right)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: blast from AF031887.1, inconsistent gene model?
  • Localisation record: microneme during oocyst sporozoite, not during schizont and salivary gland sporozoite and merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11812

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_090130 merozoite adhesive erythrocytic binding protein
MKVYCNIFGFCFFISLWIPSIRGIDNPQEDFMDRFDILNNHVNIKWTNSGSLGKGDFKFDIYDEDNINSKFNTLESAQLC
SNHENDGIYRGSCPDYGKTFSMNLDKDEYNEDFLNEISLGLLNKKLLIDLEIPVNMSGLAMYQGLFANCPYDKNHANDIK
NEKEYDMCFDKFYRNKQNISTRIKKQLLISKYTYFGSHGLGGRLGSNTEYPLHIYNPIENYKTKQMRYPKLVETLEDCSI
YSHCIGPCFDRDFDNKCFRDLPVAFNHKTKECIIIGTHEEKKTKNCNSDHSRNNGRCFSSIKKEKGKDWTYVSSFLRPDY
ETKCPPRYPLNNSEFGYFNYNTGKCESPTKLYDNTVISFNQCIEKLFSFNYANENPDQKRSNYLWGVWVLENKQNKLNSM
NDLGVCVLLKERPTCVLKKQNYYSFTNLTANYFDNNQNIEYPDIENVKIGKNRNSELSGNLTYNDKKFKNSNINKGMVIS
MNDISEIKENSKLQTNKRNEGKKTKYGLYNYPITPISYLQINHKRELTKKYMYFENSLTPSHNTGASIRYEGNNRLGIDA
NNNRRNTYGTQDINLKRNNNYKQPKNKLNPQAEYMDRFDIEKNHIYIDWKQDGKYGSDKLKYNIISHETANTVQSLLITD
KNDICPNHYSPGRAQGSCPNYGKSIIVKALEGTNGDEYFNLNFLNEIRTGYLNRYMKYDVELPYEKSGLAMHHGDLNECP
KSLDEENLYKIKSDYNYGMCKSTVLKSNVPFKTYNYRTKKLLYFGLYGLGGRLGSNMSKIKNIFKSRPNNITLPMFNPSL
IKNLLDCSLYSYCLGPCLENAYNNKCFRNLPAYFNHETKECVILGTHEQERVNDCRKRKEDINKPNCQDVRKTPLSKDWT
YVTSFIRPDYEEKCPPRYPLKFKSFGKYDEATGKCKSLINKEYIIDIPWFASCLEYMFIMSPDVSQRSEKKRYWGVWIAD
KSVNSSNLDEAKGKCYYITEKPNCVIDKVNHFSFTSLTTNDIDFDQNINLEKLDELVINNDQSSSHNRAKYNKPIGNYEY
TIVRKHKSSPEHSSSVNTNSYTQNRMEEKFAKEIDSTRSTDRSRMDEVIRVREEAEKNAKIIRKFEELRIADMIKKRKEA
GENAEEVKKAEEERKRIEAAKKVEEERKKAEAAKKAEEERKRIEEAKKVEEKRKKDEAAKKAEEKRKKDEAAKKAEEKRK
KDEAAKKAEEKRKKDEAAKKAEEERKRIEEAKKVEEKRKKDEAAKKAEEKRKKDEAAKKAEEKRKKDEAAKKVEEERKRI
EEAKKVEEKRKKDEAAKKAEEKRKKDEAAKKAEEKRKKDEAAKKAEEKRKKAEAAKKAEEKRKKDEAAKKAEEKRKKDEA
AKKVEEERKKAEEAKKAEEERKRIEEAKKVEEKRKKDEAAKKVEEERKKAEAAKKAEEERKRIEEAKKAEEERKRIEEAK
KVEEKRKKDEAAKKAEEERKRIEAAKKVEEERKRIEEAKKAEEERKRIEEAKKAEEERKRIEEAKKVEEKRKKDEAAKKA
EEERKRIEAAKKVEEERKRIEEAKKAEEERKRIEEAKKVEEKRKKDEEAKKAEEERKRIETAKKVEEERKKAEAAKKAEE
ERKRIEAAKKVEEERKRIEAAKKAEEERKRIEEAKKAEEEIKKDSNLAEKKISSSNYETRHIDDNSFKKLDEAEYKSRNI
DSTRNKIISMSKENMCINDISSKYCDYMKDKISSGSCSNDERKQLCCSISDYCLNYFDYNSNKYYDCTKREFSDPLYKCF
SKEEYSKTVYFAGAGIIMSILIAICLKLIGGRWFKEVAFDEIVEDYDKVYTLAMISNEQI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_090130

General Sub-Cellular Localisation Links