ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_082690 ()

protein kinase, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_082690 protein kinase, putative
MDELGENCAEKEKNNKLYFYYENKLNLYNDNLFENIINNTNKDFNFNDKNSRKLMTNISLTKNTNDLFNIRLLEDEKNDI
VYKMKNNNSNISNNNTYSKEGKNSDKTNLQNNPDNLLKNINNINNNNNEYMFNYLNVYINKKIKNKPGDNNTNNTSTSIN
NSNLVAEPNNIMNNKDISKITRITINDVSDFRNVKNTSSDENNIVKDTSILASGIYKVNSYQKDKSNNNANDNTTHNSNV
NTSLNVRAVPSTCDSSVNFHCNKIYPFDDIEKNHEMKENNINNNEQTRKCFNSDTYFTNEMNINKMGNIKNSDKVCNFIN
CSNDIKKNVMINPDFQGKLNSITTDRKMGDKILFQDENKIYKNFRFPQSTNTNIDGKNLTKQNQNINSQDCENNVSTFKK
NNINDNPTKFVSNEHVSDNNLTNNTDKKIQNNNISSYATNPGIKPPSLTQKDKLQRIEDKENYKSFLNVINKRMENFSRA
KNMISAENLYKKPDCSEKDENIHIRHEEIDKEKIENTHKHNNNEINKNNCTLNDSKKSSCNNSRSSSIENDNNNNVKNTN
LDDSKIIYDQHKLNNNQSGNSSMKSLERYTQIYPYSEGVETNISNNNNSTSNMETLNNTYIFSSPKSGNYNNNQLKRIND
NNRCNNNTCNQILSNINYKDNMHNSNLNMIEEEIKREQLLGNKNQLNIIHQNNLTNYIACGDINLSNDNNIAPKNSPNKQ
IIYKDEFNVNKGNLIDNINHGPIFNNPDNYTNRENCYNSRKEYFINENINNAMFSGDYLMTYSGKKDPLDIEDGMRDENN
FVNSDEYFTNHYGGETRIKDSQFFGNKVYPIMNSTCRYNNTPTPKENVIGAHNSKNDNLFCLNSNKQCAQIKNYNNSTTM
ETTDSFNNISSVGSKYNFLTEAPKHQNNSNHNNNDANINSTLSAFNDCAKDGNDNRSNSGNCAFGDRYYSQPNYDNNNKI
ALKNVKHCDKSVLKSVDKNVQHKNYHHKSFHKKFHEDLPHSDHYNLANSISSPNIFSNVVNTNYFGTQIGELKKENLNDI
TTEYNKIPNNIISTSYEMPIYTQSDQIINGFAIDNNNNIEKNANLNEQILKKKTKKKYLFNSNEEENNSSVQGCSNKRNY
SNSIDGDSMKSVDSGRSICSKLEGGIATLPSRNNYNNNIIDDKINGNIITSFTTHNNILSNISEEQGTGCSTTCNSDIGN
SIHIFNNNNNNNNNNNNNNNNNNNNNDNNNNNDNNNNDNNNNNDNNNNNNNNDNNNNNDNNDNNNNDNNNNDNNNNDNNN
NTIDKNSECNKNHYISNIYYEQNLKSEEDGTYTKCNKDRNTIFCNTRENNNLMKKNIKSNVKTYFILDKKENINVTQNNR
SNIIQIENNNDASRTSIKKETLFSELDSSNTHKYNEIHTRNPEYTTSDNRIRINNNAKQVNLSIDGSSTTPNFSNMAHMN
NSDCGQDPLQYPSNMFISNNNASNNNVNENNNHCINSTRMGINSFDKINYSNWKKGSGIVKEMEMNKYPYKNSIHIDNNN
NNNKNNNQINYMNILHDSIKYSTNNKQDAYTNKYVNMKIKNMDENMNIDYTNRRFVNNNATLKNTLCNNNGSHLVINTNY
LFQGNGNIIKNIHLGTNEYSIEMEGKPDHPDTVSGVNTKISNTIKENKNIISRKNVGANKLMHNFDFNLIEGNNIDNNNS
KINKLVAFKRNNDSNNLLESNEKQNLKISRSSEEANNSETHINNKNKIYTETSLKGVNMNNNGIINRNTVANYKVNNILI
NDKLKNILLSKNFNNFLIENDNKIAIRNSINNPYSNIGNINTNNVGRNIGENENEACLSNATTIAVLKNSNVLSGNNIPK
LKESYNYYSHIKPYIPSNNNVINKKITEFSENNKIQDINGIYNNHIGQGNTVIDTKKNISMNINKEYNNKYVSYINKSIG
SSPNTNNILNYIESVYNIYPPLLNAKNKINRDEKTCGTNFNDNVINIHNQQRQISKIENENKYYNNINAQEGINKKIVNL
NFQDILICKQNNLNIDKVNKKKYDPNFSNYGNSSGIASMNNKNIDRQFTNGKISNTPINDINNNRNIVSKSPNNFQTGGD
INKSRIKENDLFSSINNISSKSSCNDMHISHQENFQEKRPIIYGDTKIPKEKKITLLGTGNKNSVHISCVSGVIGSIENN
NMSSIYSNLTNSNSYFQNRGEITTKNTISYNPTHNNNNNNNNSGMNSQAIVGIKNENKLINNRKGLVLSSNHNKRIDQTD
DKKIENICNNKKGVIMHDINKNKFYDIFLCNKKNYISNNNNNLYTNLNNNNNNMRSTIQNAEYFYSKMMQNNNLTRYNDE
LIKTTDRNDAVNVVDSNSISPSTTSLPNNSPNITKTEMENLNNNCINEKDLNYYKNINYKNMDADNYVLYHQQEKDNSEK
YIKNRNYIPNDNNIKIKSIHKQNNDHNSHILRNINMNANITNNNLIMNKGVIKNLGNITDKPVNYFNENRYYMNEIQQQS
IIGNKYEPHNNENNSNIGSGIVLNTIESNNKKEEYDENVFRISKSQFVSLEKDIKYLQSLTLHNINSKDLYFEAYEEKEI
FPYDHNGVEANTNYYFNNSEKKNNEYIFINDHGINDSKLFNNTSANDISNNGSGSCVKKEMKKTKVYTNKLNTSLKYTVI
EEGSFGVVYKGWYKNMHVAVKVPVEKMVKQDPYGLTKRSINEWKILSKCEHPNIIKLHGGIIHSYFDIWLVTKLINGSDL
HTIKNNMNKEEKVLSVDISLKMCRQLAAVINFLHTPIKNKKNVIIHRDIKPENLIIDSDWNIHLCDFGDSEETEDGNVSN
VSGATWIYAPPELLTCHPLKQSSDYNFLDYAQLSYKWDIWSMGCVFQEMMNLPSPFQHYIISFDESDQIYEKLVDVFTKK
LPPCIHSKIDNSPFADIIKLCLNYDPNLRPTAKEIVDLLNQPNEYLLLKRR

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_082690

General Sub-Cellular Localisation Links