ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_082420 (MAOP)

perforin like protein 3, a gene from Plasmodium berghei

Compiled localisation
microneme during ookinete

Who localised this protein by microscopy?

Kadota, K., Ishino, T., Matsuyama, T., Chinzei, Y., Yuda, M.
Essential role of membrane-attack protein in malarial transmission to mosquito host. (2004 Nov 16, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme during ookinete
  • "Immunofluorescence analysis showed that MAOP production was restricted to the ookinete stage (Fig. 1A). Signals were mainly localized in the apical end of the ookinete and showed patchy distribution, suggesting localization in micronemes. "
  • Microscopy type: Electron
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AY756182
  • Localisation record: microneme during ookinete
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_082420 perforin like protein 3
MMFKRKYLFFPCFFLIIVNILHKLDNLGADESLLYFHIRILSMNKNDTQELYNNKVKIFNNEILSGLQHEHTIEDERIRK
FVSNDADSKHGRRIKKVTLKLPKNRVDRMQNIRKINFNEMRQNDDANPEINKPNITHETYPALEPSKHNKNKQMSNVKNK
VNNFVKLMKDINDNMENEKEKERNNPNTEDNIYNDEHHTVVIYDGLDENKDLYNKYKIETENNMDTKIIQGTEYLGVGYD
FLFGNPIGDPFLKVDPGYRDSVIKLTYPKSDVDYPDNYININPNGSYVRNEISCNRSENETEISTMSEYTKELSVDASLG
GSYGLFGSFSASVGYTSASNTISKKKFRMFILKSYCFKYVASLSQYSQWKLSDQFLRAIALLPSYFNSLEHDGKYCNAEE
LRYNKTGMENCGKSVESWLYFFKNFGTHVSTVIHLGGKITQQVKISKNEYKSLNESGLSTSVSASVGFGLFKANASTSTD
SKESSHEESSNSSIEKETVIIGGTTIYDPNDPSNFEKWADSIKNNPMPIKGQYEPLSRILPERLNKIYDEALSFYVSLNV
PINIGSKTDGEIKNYNIKDQLMKSKMIHGSGSGLVVLECEDKQNFILGFSLSIPNDLSNLKDFYMNTCDEESDKCYSKMS
DNAYSYIFAMCNDDSIPYLEQKAKSGTGLLTLECSEKNQIILFGFGISVLNSNDPISIAIYPCKNGKTSCSMQGSTDQSA
VGLWIVCGHEESLNSNFSVYVRKLEKDNVSGKKKKKIDICPTEVLFNLIFEFTKTPINKRNGKCFTVNDICPKDFHVCSD
NKGIKSFNYYSVSVY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_082420

General Sub-Cellular Localisation Links