ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_081990 (SET)

nucleosome assembly protein, a gene from Plasmodium berghei

Compiled localisation
nucleus during gametocyte and late schizont and microgametocyte and midgut oocyst and ookinete and ring and trophozoite

Who localised this protein by microscopy?

Bushell, E. S., Ecker, A., Schlegelmilch, T., Goulding, D., Dougan, G., Sinden, R. E., Christophides, G. K., Kafatos, F. C., Vlachou, D.
Paternal effect of the nuclear formin-like protein MISFIT on Plasmodium development in the mosquito vector. (2009 Aug, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during microgametocyte
  • "The presence of MISFIT in the male gametocyte nucleus was corroborated by co-localization experiments with SET (Figure 3A), a protein putatively involved in chromatin dynamics, which also strongly accumulates in male gametocytes [23]."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA 2.34, ANKA 2.33
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus during male gametocyte
  • Other genes localised in this publication: nuclear formin-like protein, 25 kDa ookinete surface antigen precursor

Pace, T., Olivieri, A., Sanchez, M., Albanesi, V., Picci, L., Siden Kiamos, I., Janse, C. J., Waters, A. P., Pizzi, E., Ponzi, M.
Set regulation in asexual and sexual Plasmodium parasites reveals a novel mechanism of stage-specific expression. (2006 May, Mol Microbiol) PubMed / full text
   more detail about this publication

nucleus during gametocyte and late schizont and midgut oocyst and ookinete and ring and trophozoite
  • "The A-SET/GFP line of P. berghei expresses GFP-tagged SET in the nucleus of all erythrocytic stages .. As shown in Fig. 2A, GFP fluorescence superimposed on anti-SET signal while it did not overlap with the endoplasmic reticulum (ER) marker Bip."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: ANKA
  • Gene model mapping comments: blast from AAD03402.1, annotation matches, inconsistent gene model?, forward and reverse primers from 16677299 match to different genes as of PlasmoDB 6.1. Problems in assembly?
  • Localisation record: nucleus during ring and troph and mature schizont and gametocyte and ookinete and midgut oocyst
  • Other genes localised in this publication: 25 kDa ookinete surface antigen precursor, heat shock protein 70, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13064

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_081990 nucleosome assembly protein
MKRDRSENSVENTTDPKHSKIDNDDPLIPFIKDFEDIQKDIEQLDIKCAHEQMNIQKQYDEKKKPLFDKRDVIIQKVPCF
WANTLRKHPALSDIVPEDIDILNHLTTVDLKDNMDNNGSYKITFTFNEKAKEYMEPLVLVKHVTFDNNQEKVVECTRIKW
KEGKNPIAAVSNSRIDIDNEMPKWSVFEWFTTEELQDKPDLGEIIRREIWHNPLSYYLGLEDFDDFDEDFDDEDDEDEDD
ENEDEDEDDDEENEEDEDDEDGKDNDD

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_081990

General Sub-Cellular Localisation Links