ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_071330 ()

protein kinase c inhibitor-like protein, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_071330 protein kinase c inhibitor-like protein, putative
MGLKLILAYLILYLDLMKPGFGLIGNNIKNAAFNCFTNIVYKNKYLTNVVNKKLMKMSDEEERAIAAAGKDENGDSIFGK
IVRKEIKADIVYEDDKVLAFNDINPQAPVHILVIPKMRDGLTRLSKAEEKHKEILGHLMWAVAEIVRKNNLGDFRLVVNN
GPEACQSVYYLHLHILAKRQMKWPPG

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_071330

General Sub-Cellular Localisation Links