ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_071190 (hsp70)

heat shock protein, putative, a gene from Plasmodium berghei

Compiled localisation
cytoplasm and not erythrocyte cytoplasm and not erythrocyte plasma membrane and nucleus during hepatic
transformation bulb during early hepatic
during sporozoite

Who localised this protein by microscopy?

Kaiser, K., Camargo, N., Kappe, S. H.
Transformation of sporozoites into early exoerythrocytic malaria parasites does not require host cells. (2003 Apr 21, J Exp Med) PubMed / full text
   more detail about this publication

transformation bulb during early hepatic, during sporozoite

Kumar, N., Nagasawa, H., Sacci, J. B. Jr, Sina, B. J., Aikawa, M., Atkinson, C., Uparanukraw, P., Kubiak, L. B., Azad, A. F., Hollingdale, M. R.
Expression of members of the heat-shock protein 70 family in the exoerythrocytic stages of Plasmodium berghei and Plasmodium falciparum. (1993, Parasitol Res) PubMed / full text
   more detail about this publication

cytoplasm and nucleus and not erythrocyte cytoplasm and not erythrocyte plasma membrane during hepatic
  • "Antibodies against Pfhsp reacted with nuclei and cytoplasmic regions, whereas anti-Pfgrp antibodies were localized in the perinuclear membranes and in the membranous regions reminiscent of endoplasmic reticulumlike structures in the parasites. Unlike the immunofluorescence results of Renia et al. (1990), no apparent reactivity of antibodies against Pfhsp and Pfgrp was observed in the host-cell cytoplasm or on the surface of infected hepatocytes."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: ANKA
  • Gene model mapping comments: blast from homologue PF08_0054
  • Localisation record: nucleus and cytoplasm and not RBC cytoplasm and not RBC membrane during hepatocyte
  • Other genes localised in this publication: heat shock protein 70, putative

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_071190 heat shock protein, putative
MANAKAKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDA
KRLIGRKFTESSVQSDMKHWPFTVKSGIEEKPMIEVVYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAY
FNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLG
GEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSLFEGIDYSVTVSRARFEELCID
YFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAV
QDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPAP
RKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSPEEIDRMVNDAEKYKAEDEENKKRIEARNSLENYCYG
VKSSLEDQKIKEKLQPNEVETCMKSVTSILEWLEKNQLAGKDEYEAKQKEAEAVCSPIMSKIYQDAGAAAGGMPGGMPGG
MPGGMPGGMPGGMPGGMPGGMNFPGGMPGGMPGGMGAPAGAPAGSGPTVEEVD

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_071190

General Sub-Cellular Localisation Links