ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_070280 (PDI)

protein disulfide isomerase, a gene from Plasmodium berghei

Compiled localisation
apical during ookinete

Who localised this protein by microscopy?

Lal, K., Prieto, J. H., Bromley, E., Sanderson, S. J., Yates, J. R. 3rd, Wastling, J. M., Tomley, F. M., Sinden, R. E.
Characterisation of Plasmodium invasive organelles; an ookinete microneme proteome. (2009 Mar, Proteomics) PubMed / full text
   more detail about this publication

apical during ookinete
  • "M1 aminopeptidase and PDI, the former a recognised target of drug development, were both shown to have a micronemal location by IFA."
  • Microscopy type: Light
  • Microscopy method: antibody to homologue
  • Strain: ANKA 2.34
  • Gene model mapping comments: Taken from supplementary table (sm003) of 19206106
  • Localisation record: apical during ookinete
  • Other genes localised in this publication: M1-family aminopeptidase, putative, circumsporozoite- and TRAP-related protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10306

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_070280 protein disulfide isomerase
MNTKYISFFLFIIPFIFKNYVRSHEDLFNEHITSIHDGELNNFITKNDIVLVMFYAPWCGHCKRLIPEYNEAAIMLSEKK
SEIKLASVDATVERGLSQEYGITGYPTMILFNKKNRINYGGGRTAQTIVDWILQMTGPVSTEITGNIEDVLKESNINVAF
YMEYISEDNELFKKFNEVGDKNREIAKYFIKKNDKHNKIYCYRKDEKTVEYDEKTPLNDFVAIESFPLFGEINTENYRFY
AESPKELVWICATIEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPGLAYQSSEGRYLLANPQQSLK
NHKDIISFFKDVEAGKIEKSLKSEPIPEEDKNAAVKVVVGNSFTDVVLNSGKDVLIEIYAPWCGHCKKLEPIYEELGRKL
KKYDHIIVAKMDGTLNETSLKEFEWSGFPTIFFVKAGSKIPLPYEGERTLKGFVDFLNKHSTKTPITIDDVSQSYEGSSE
EL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_070280

General Sub-Cellular Localisation Links