ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_052480 (SEP1, SEP3)

early transcribed membrane protein, a gene from Plasmodium berghei

Compiled localisation
parasitophorous vacuole membrane during early schizont
vesicles near parasite surface during blood stages

Who localised this protein by microscopy?

Birago, C., Albanesi, V., Silvestrini, F., Picci, L., Pizzi, E., Alano, P., Pace, T., Ponzi, M.
A gene-family encoding small exported proteins is conserved across Plasmodium genus. (2003 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during early schizont, vesicles near parasite surface during blood stages
  • "Immunolocalisation results indicated that PbSEP1 is targeted to the membrane of the parasitophorous vacuole up to the early phases of schizogony, while, in late schizonts, it re-locates in structures within the syncitium. After erythrocyte rupture, PbSEP1 is still detectable in free merozoites ... In synchronous P. berghei clone 8417HP anti-PbSEP1 antibodies decorated the periphery of parasites all along the erythrocytic cycle"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AJ420905
  • Localisation record: PVM during early schizont, vesicles near parasite surface during erythrocytic stages
  • Comment: strain information not found
  • Other genes localised in this publication: early transcribed membrane protein 14.1, early transcribed membrane protein 11.2, early transcribed membrane protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_60511

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF11_0039 early transcribed membrane protein 11.1
  • PY04799 early transcribed membrane protein family
  • PCHAS_050120 early transcribed membrane protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_052480 early transcribed membrane protein
MKLAKALYFVAFLLAIKVLTPGSNNYVEAKPANSKKVTKSGDNAFIKKIKNNKAAFISTLAATVALAIATTFGVMHYQNN
GNDKKKPSGLDGKTPLIIPRKKTPSASDNDSVPPS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_052480

General Sub-Cellular Localisation Links