ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_041770 (Alpha tubulin)

alpha tubulin 1, a gene from Plasmodium berghei

Compiled localisation
microtubule during activated microgametocyte and microgamete mitosis
cytoplasm during microgametocyte

Who localised this protein by microscopy?

Tewari, R., Dorin, D., Moon, R., Doerig, C., Billker, O.
An atypical mitogen-activated protein kinase controls cytokinesis and flagellar motility during male gamete formation in a malaria parasite. (2005 Dec, Mol Microbiol) PubMed / full text
   more detail about this publication

microtubule during activated microgametocyte
  • "Immunofluorescence staining of ?-tubulin identified the typical dynamic microtubule structures in ?Map-2 microgametocytes that were previously observed in activated wt microgametocytes by light and transmission electron microscopy"
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody to homologue
  • Strain: ANKA clone 234
  • Gene model mapping comments: annotation matches
  • Localisation record: microtubule during activated microgametocyte
  • Other genes localised in this publication: 25 kDa ookinete surface antigen precursor

Billker, O., Shaw, M. K., Jones, I. W., Ley, S. V., Mordue, A. J., Sinden, R. E.
Azadirachtin disrupts formation of organised microtubule arrays during microgametogenesis of Plasmodium berghei. (2002 Nov-Dec, J Eukaryot Microbiol) PubMed / full text
   more detail about this publication

microtubule during microgamete mitosis, cytoplasm during microgametocyte
  • "Anti-tubulin antibodies revealed that in uninduced preparations microgametocytes exhibited a generalised weak fluorescence throughout the entire cell (Fig. 2A). At 1 min post-induction (PI) a single band of fluorescence was detectable spanning the dark nuclear area. Not infrequently ends of these single bands were decorated by two to four bright dots (Fig. 2B-D). At 6 min PI four distinct bands were visible at the nuclear periphery; these often appeared as two pairs of parallel bands, each pair in a separate focal plane (Fig. 2E, F). At 7 min the bands had become elongated and appeared thinner in the middle region (Fig. 2G, H). At the completion of this division these spindles retracted to eight dot-like structures, each closely associated with a ring of fluorescence, which occupied the periphery of the cell (Fig. 2 I, J). In cells that were suitably positioned, serial sectioning resolved the peripheral ring of fluorescence into a basket of six to eight elongate bands coiled tightly around the nucleus (Fig. 2 K-P). At exflagellation (10-15 min PI) the microgametes emerged from the cell, each containing one of the fluorescent cytoplasmic tubule complexes (Fig. 2)."
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody to homologue
  • Strain: ANKA clone 234
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microtubule during microgamete mitosis, weak cytoplasm during microgametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_041770 alpha tubulin 1
MREVISIHVGQAGIQVGNACWELFCLEHGIQPDGQMPPDQAGRANDDAFNTFFSETGAGKHVPRCVFVDLEPTVVDEVRT
GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEVIDVCLDRIRKLADNCTGLQGFLMFSAVGGGTGSGFGCLMLERLSVD
YGKKSKLNFCCWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAIMLDNEAIYDICKKNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVVSAEKAYHEQLSVSEITNSAFEPANMMAKCDPRHGKYMACCLMYR
GDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDQKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIETNDGEGEDEGYEADY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_041770

General Sub-Cellular Localisation Links