ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_040320 (CS, CSP)

circumsporozoite (CS) protein, a gene from Plasmodium berghei

Compiled localisation
gliding trail during salivary gland sporozoite and sporozoite
surface during after sporozoite invasion of hepatocyte and day 12 oocyst
apical during merozoite
host cell cytoplasm during after sporozoite invasion of hepatocyte and hepatic
host cell nucleus during 2 hours after sporozoite invasion of hepatocyte
not host cell nucleus during 8 hours after sporozoite invasion of hepatocyte
outer nuclear envelope during hepatic
plasma membrane surounding oocyst cytoplasm during oocyst

Who localised this protein by microscopy?

Pastrana-Mena, R., Dinglasan, R. R., Franke-Fayard, B., Vega-Rodriguez, J., Fuentes-Caraballo, M., Baerga-Ortiz, A., Coppens, I., Jacobs-Lorena, M., Janse, C. J., Serrano, A. E.
Glutathione reductase-null malaria parasites have normal blood stage growth but arrest during development in the mosquito. (2010 Aug 27, J Biol Chem) PubMed / full text
   more detail about this publication

surface during day 12 oocyst
  • "Day 2 and day 12 oocysts stained with antibodies against different oocyst proteins: Pbs21, a surface protein of ookinetes and young oocysts; PbCap380, a protein of the oocyst capsule and PbCSP, a surface protein of sporozoites."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during day 12 oocyst
  • Other genes localised in this publication: 28 kDa ookinete surface protein, oocyst capsule protein

Rennenberg, A., Lehmann, C., Heitmann, A., Witt, T., Hansen, G., Nagarajan, K., Deschermeier, C., Turk, V., Hilgenfeld, R., Heussler, V. T.
Exoerythrocytic Plasmodium parasites secrete a cysteine protease inhibitor involved in sporozoite invasion and capable of blocking cell death of host hepatocytes. (2010 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

gliding trail during salivary gland sporozoite, host cell cytoplasm during after sporozoite invasion of hepatocyte
  • "Like the shedded surface protein CSP, PbICP was detected in a patchy pattern in the trails of the circling sporozoites. To confirm export of PbICP into the host cytoplasm, we compared the localization of PbICP with that of CSP, a molecule known to be secreted by young trophozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: patchy trail during salivary gland sporozoites, host cell cytoplasm during after sporozoite invasion
  • Other genes localised in this publication: inhibitor of cysteine proteases, thrombospondin-related anonymous protein, circumsporozoite-related antigen

Srinivasan, P., Fujioka, H., Jacobs-Lorena, M.
PbCap380, a novel oocyst capsule protein, is essential for malaria parasite survival in the mosquito. (2008 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

plasma membrane surounding oocyst cytoplasm during oocyst
  • "Circumsporozoite protein (CSP), the most abundant sporozoite surface protein, also localizes to the plasma membrane surrounding the oocyst cytoplasm (Nagasawa et al., 1987; Wang et al., 2005)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: plasma membrane surounding oocyst cytoplasm during oocyst
  • Comment: strain information not found
  • Other genes localised in this publication: oocyst capsule protein, 25 kDa ookinete surface antigen precursor

Singh, A. P., Buscaglia, C. A., Wang, Q., Levay, A., Nussenzweig, D. R., Walker, J. R., Winzeler, E. A., Fujii, H., Fontoura, B. M., Nussenzweig, V.
Plasmodium circumsporozoite protein promotes the development of the liver stages of the parasite. (2007 Nov 2, Cell) PubMed / full text
   more detail about this publication

host cell cytoplasm during hepatic, host cell nucleus during 2 hours after sporozoite invasion of hepatocyte, not host cell nucleus during 8 hours after sporozoite invasion of hepatocyte
  • "The intra-nuclear CS signal peaked at two hours after sporozoite invasion of hepatocytes, diminished gradually afterwards, and was undetectable after eight hours (Figure 3B), suggesting that CS was actively exported out of nucleus."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from homologue PFC0210c
  • Localisation record: Host cell cytoplasm during hepatocyte, host cell nucleus during 2h post sporozoite invasion, not host cell nucleus during 8h after sporozoite invasion
  • Comment: strain information not found
  • Other genes localised in this publication: -

Kaiser, K., Camargo, N., Kappe, S. H.
Transformation of sporozoites into early exoerythrocytic malaria parasites does not require host cells. (2003 Apr 21, J Exp Med) PubMed / full text
   more detail about this publication

surface during after sporozoite invasion of hepatocyte, apical during merozoite

Hugel, F. U., Pradel, G., Frevert, U.
Release of malaria circumsporozoite protein into the host cell cytoplasm and interaction with ribosomes. (1996 Oct 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

outer nuclear envelope during hepatic
  • "The intracytoplasmic deposition of CS protein begins during the attachment of the sporozoite to the host cell surface and reaches its peak during the first 4-6 h after invasion. Initially, the CS protein spreads over the entire cytoplasm of the infected cell where it interacts with cytosolic as well as endoplasmic reticulum-associated ribosomes. During the subsequent development of the parasites to exoerythrocytic forms, the CS protein binding becomes gradually restricted to ribosomes lining the outer membrane of the nuclear envelope of the host cell."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Outer nuclear envelope during hepatocyte
  • Comment: strain information not found
  • Other genes localised in this publication: -

Stewart, M. J., Vanderberg, J. P.
Malaria sporozoites leave behind trails of circumsporozoite protein during gliding motility. (1988 Aug, J Protozool) PubMed / full text
   more detail about this publication

gliding trail during sporozoite
  • "As Plasmodium sporozoites undergo gliding motility in vitro, they leave behind trails of circumsporozoite (CS) protein that correspond to their patterns of movement."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: sporozoite trail during sporozoite
  • Comment: no fulltext available to UniMelb online
  • Comment: strain information not found from abstract
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_40533

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_119355 circumsporozoite protein precursor, putative
  • PVX_187290 circumsporozoite protein, truncated, putative
  • PKH_083560 circumsporozoite (CS) protein precursor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_040320 circumsporozoite (CS) protein
MKKCTILVVASLLLVNSLLPGYGQNKSIQAQRNLNELCYNEGNDNKLYHVLNSKNGKIYNRNTVNRLLADAPEGKKNEKK
NEKIERNNKLKQPPPPPNPNDPPPPNPNDPPPPNPNDPPPPNPNDPPPPNANDPPPPNANDPAPPNANDPAPPNANDPAP
PNANDPAPPNANDPPPPNPNDPAPPNANDPPPPNPNDPAPPQGNNNPQPQPRPQPQPQPQPQPQPQPQPQPRPQPQPQPG
GNNNNKNNNNDDSYIPSAEKILEFVKQIRDSITEEWSQCNVTCGSGIRVRKRKGSNKKAEDLTLEDIDTEICKMDKCSSI
FNIVSNSLGFVILLVLVFFN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_040320

General Sub-Cellular Localisation Links