ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_030500 (SERA2)

serine repeat antigen 2, a gene from Plasmodium berghei

Compiled localisation
during mosquito stages and not early blood stages and not early hepatic and not mid hepatic
intracellular during late hepatic
individual merozoites inside merozomes during merozome
parasitophorous vacuole membrane during cytomere and late hepatic schizont and terminal hepatic
internal structures during cytomere and late hepatic schizont
host cell cytoplasm and parasitophorous vacuole during terminal hepatic

Who localised this protein by microscopy?

Putrianti, E. D., Schmidt-Christensen, A., Arnold, I., Heussler, V. T., Matuschewski, K., Silvie, O.
The Plasmodium serine-type SERA proteases display distinct expression patterns and non-essential in vivo roles during life cycle progression of the malaria parasite. (2010 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

during mosquito stages and not early blood stages and not early hepatic and not mid hepatic, intracellular during late hepatic, individual merozoites inside merozomes during merozome, parasitophorous vacuole membrane during cytomere and late hepatic schizont and terminal hepatic, internal structures during cytomere and late hepatic schizont, host cell cytoplasm and parasitophorous vacuole during terminal hepatic
  • "Similarly to SERA5 in P. falciparum (Delplace et al., 1987), both PbSERA1/mCherry and PbSERA2/mCherry were detected in late schizonts, but not in early blood stages (Fig. 3B). ... In contrast, PbSERA2/mCherry became detectable only at the end of liver stage development, with an intracellular distribution in the parasite (Fig. 3D). Interestingly, PbSERA1/mCherry was not detected in merosomes, in contrast to PbSERA2/mCherry, which gave a strong signal associated with individual merozoites inside merosomes (Fig. 3E)."
  • Microscopy type: Light
  • Microscopy method: 3' mCherry tag
  • Strain: ANKA
  • Gene model mapping comments: blast from EU917225, inconsistent gene model?
  • Localisation record: not during early blood stages, barely during mosquito stages, not during mid liver stages and early liver stages, intracellular during late liver stages, individual merozoites inside merozomes during merozome
  • Other genes localised in this publication: circumsporozoite-related antigen, serine repeat antigen 1
  • "In contrast, anti-SERA2M antibodies showed a more complex distribution in late liver schizonts and cytomeres, staining both the PVM and more internal structures (Fig. 4B, upper and middle panels). ... Interestingly, in terminal liver stages, just prior to the release of merozoites, SERA2M was detected at the periphery of the parasites, in the PV and/or PVM compartment, as well as the host cell cytoplasm (Fig. 4B, lower panels)."
  • Microscopy type: Light
  • Microscopy method: antibody to middle of protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM and internal structures during late liver schizont and cytomere, PV and PVM and host cell cytoplasm during terminal liver stages
  • Comment: suggests 2 peptides from gene go to different places at the end of liver stages just before merozoite release
  • Other genes localised in this publication: circumsporozoite-related antigen, serine repeat antigen 1

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_030500 serine repeat antigen 2
MKTYIPLIFLLYAMLGNDIINCRPVPEPFGSEVTTSGTTGGSQKETTSTTGKNTSELESKKDNPSEKSQDPSTPSSNTAT
LPGSPGTSGTPNPSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSGTTSETPGTPTGTERSLSPQPQNSQPQNSQ
TQDSQTQDSQTQQQSQRSEATTGSDSSKNATEEPQSDDASISSNETNVVNNSVIKPRIVHKGTVESALLKNYKGVKVTGL
CGDEVGIFLEPHIYINVESKINNIELSAKFPSIHGQYITIFSEESPLKNKCHENDDHLYYKILVYLEGDILTIKWTTFSI
NPETNKCELCTNRNNENTNVDVKKFRIPKLETPFTTIQIHSLLTKENKIVVKTKDYSLIDDIPKKCDIIATKCFLSGKTD
IEPCYTCNLLTENIPRNDECYNYSSPLVKEYNQILTIGQSDEDNIENQNLSLVDSINNILNDIYIIDEQNNKILIDVEDL
NTNLKKELTYYCQILSEVDTSGTLDIYKIGNSVEIFNNLIRLLKNHQNENRLYIINKLKNPAICMKHVEQWVANRKGLKL
PIILDDAETENKNLEELNNTNSTINYEEGLDGIIDLTKTIDDEPVSPLGLLANKLDAFCNNEFCDRLKDKTSCVSKIDVE
EQGNCATSWIFASKYHLETAICMKGHDNFNTSALYVANCSKKDPKDKCLSGSNPLEFLDILQANNYLPTESNYPYNYKHV
GDSCPETNQTWVNLFDKLKLENSNDGNNSIIKGYTSYESKDYKSNMNEFVGIIKNKIKKLGSVIAYAKFNDFMGYDFNGN
KVHKLCGSGTPDMIVNIIGYGKYINENNEVKSYWIVRNSWGKHWADEGNFKVDIETPENCEHNFIHTALVFDFDLPPAQK
NNNDASIYNYYLKNSPNFYKNLYYNHVSKTNAETAIFGQDETVQLSNAAGGGSNQVATTINTVTSQLASGATTQINQPST
TTQGQAPQSQTCPSSAVTPSQTPSGSSSGSGPTPSGGNNTSHQNNPGQSGASVQPNPSTTVETPENGGGSTERQTNSTQN
TEIFHVLKVIRKKKVQTSLIKYNTYDEVEEHSCSRAMSTDSSKKEKCVTFCSNNWDSCSFNLYPGYCLNKLKGDNECNFC
AV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_030500

General Sub-Cellular Localisation Links