ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_030440 ()

merozoite surface protein 4/5, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_030440 merozoite surface protein 4/5
MKAVNYLSLINLFVVLLMSFKNVHDISLINTKKNPRNIFCAKRILGDSPSGNSSTSSNQNEGNDNSNLATNKGNTNDSDK
PNGNNIPNPQSKSENANISEPDKAGSASNPPQPDNTNGDPENSIHSEDDEDDDEEDCSVNNGGCGENLLCEKMENGVIKC
SCPSGYKLHGTNCIALLSAYSVNYSFCGILMILIILVSIIY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_030440

General Sub-Cellular Localisation Links