ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_010610 ()

para-hydroxybenzoate--polyprenyltransferase,put at ive, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_010610 para-hydroxybenzoate--polyprenyltransferase,put at ive
MKRYIRLNSYKYMDKQNEKNSNRYIPNFINSNYKNGIENSQIIFEKNFKHNKILSQFGKIKNKLIYPLQFELNEKNGNIL
KYTKPILKKRIKNITNNGIKANIRNKLITKINEPNLKSLYLEKLHYSSNLNVNNEEKTNNKFKEIIKKNINNYIIFSRLH
IPTGTYLTLYTSLWGYLLTYDVNKLFLVNHEIYSSEINIDEIKNIIKNLCLFTFGAYNIRTFGCMINDFLDKNYDKHVER
TKNRPLADGSITTFKALVYMFIHSSLSLLALFQFSNETIYTGLFSSLFIVTYPLLKRITYYAQLYLSFTFNLGFFIASSV
NINILENLFPLIISFIPLCYLTIIYDTIYAHQDKADDIKLKLKSLAIKWDKNTIKYSKILIANMTYLLYMSAYLFDMHYS
YYIFTTFNVAYLYYLINHVSIDDKEKCMNFFKKSKNVLFLFFIASLTAKMFEALEKSHDK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_010610

General Sub-Cellular Localisation Links