ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_010540 ()

coatomer alpha subunit, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_010540 coatomer alpha subunit, putative
MLVKCETKSQRVKSISFHPKIDLVLAGLHNGIIQLWNYRIGILINKFEEHEGPVRGICFHSAQPLFVSGADDYLIKVWNI
HLKKCVFNLTGHLDYIRTVQFHLSYPWILSASDDQTIRIWNWQSRVCIAILTGHNHYVMSAEFHPVYDMIISGSLDKTIR
VWDIKLLREKNVIHSNNMNSSNDGIPGVGSISEKPYGLDVSNSLLGVNIDNGMNSHFMGSSLHHQNSNNNMFGASDAICK
FILDGHEKGINCCTFHHNLPIIASGSDDKLIKLWRYNDSKCWELDTLRGHFNNVSSLLFHKNNDDLLLSNSEDRTMRIWD
ITKRVCIHTFRRENDRFWVLTFKPNSNLIASGHDSGMVIFKFDKEKCPYDKNENSLFYCKDKQVVMYNIYTNEYVNMFPV
KKNTNPMVSNYYKLFVNNFCTTHIAIIFLYKEEDKFFYDLIICNGINTGSNNSNRNLSQPFSNSPFGVLKSWVKRGNIST
IKPASENDTPFNTESVNYIIKNKSCIYATFFSRNKYIFVEKKNINNGINNTSFSYIINIHNFPDDNLYKRIEVYFKIEHI
YSLNNNKIIICSENKIYLYDINLKSILNEMHHTDIITSVEIVKEYIAFVFKYNIVITTIDLNHLCTVHENIRIKTGTWDS
CGNKNVFIYNTHTHLKYLLTNGEKGLIKYMKESVYLFKVYNNKIYYINRKHNIISDKLNDTEYMFKLALINNDEAMAYYY
LEMYRNSQNKIENNNGKKSIYFSYNLIGYIKKKGFANLVLQIVNNNHIIFNMSIQLGHIENALKAAKKIDKKHIWNILSN
HALLLGNYEIAEYSLQKIKAYDKLSFLYFFSGNIEKLKKMLSISLLRKDFISTFLNSLYIGDIEQRINIFIQQNQCNLAL
LCSNLYNIPINLSEKEFGFDVTNCNYIPTKSFYLSPPIPLIKIKENSEKNGDPNLTYWNSSYNWPVKVIENTQNYYYTAQ
ENKIKETDKIKYKEQIGNINSNNNDLLINNQTHINSRINKLDNNPNYYNNIDKKYDDKNSSLDDNNDIWKDDVNDDDINI
DLPENHDNNLFNLNNNNKGGKIVRGENMILKGLKKNGKISDHIKAGNIQIGLKLISKKYGIINMKPFKQIIKNVYISTYA
YITPIQNFIPLKIPININEYNLPGHVHNNTNTTYITKNFLFNQVKKAHKLVTQGKFPSALSLFRNILYSMIFVNTNENEN
ENEKELNEYLNMCTNYILAMRLEEERNVTSNDDPRRSLELMAYFTCCSLQNSHLYLVLRRGMGLAWKAQNYITAGSFAKR
LINGNYENIKGSDEEIIKAKKILIVCEQKSTEQYNIDYDPNDYHNIKICSMSLTKINPNEEIVTCPFCHSIAKKSFASKL
CSNCIVAQLGIKALGFDFLNKNI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_010540

General Sub-Cellular Localisation Links