ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_064310 ()

GTP-binding nuclear protein Ran, related, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11018

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF11_0183 GTP-binding nuclear protein ran/tc4
  • PBANKA_093030 GTP-binding nuclear protein, putative
  • PY04253 GTP-binding nuclear protein ran/tc4
  • PVX_091515 GTP-binding nuclear protein Ran, putative
  • PCHAS_091400 GTP-binding nuclear protein, putative
  • PKH_091510 GTP-binding nuclear protein ran/tc4, putative
  • NCLIV_064310 GTP-binding nuclear protein Ran, related
  • cgd7_220 GTP-binding nuclear protein ran/tc4
  • Chro.70035 GTP-binding nuclear protein ran/tc4
  • CMU_006680 GTP-binding nuclear protein ran/tc4 , putative
  • TP01_0757 GTP-binding nuclear protein ran, putative
  • TA06865 small GTP-binding protein (RAN subfamily), putative
  • BBOV_IV010920 GTP-binding nuclear protein Ran
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_064310 GTP-binding nuclear protein Ran, related
MAAAAAQAVPEFKLILVGDGGVGKTTLVKRHLTGEFEKKYIPTLGVEVHPLKFQTNFGMITFNVWDTAGQEKFGGLRDGY
YIKGQCAIMMFDVTARITYKNIPNWYRDITRVCENIPIVLVGNKVDVKDRQVKARQIQFHRKRNLQYYDISARSNYNFEK
PFLWLARRLTNQPALSFVGEHAKAPEIQIDPNLVQEAERELQAAVSTAIDDDDEDL

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_064310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins