ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_061830 (P0)

60S acidic ribosomal protein P0, a gene from Neospora caninum

Compiled localisation
cell surface during tachyzoite

Who localised this protein by microscopy?

Zhang, H., Lee, E. G., Liao, M., Compaore, M. K., Zhang, G., Kawase, O., Fujisaki, K., Sugimoto, C., Nishikawa, Y., Xuan, X.
Identification of ribosomal phosphoprotein P0 of Neospora caninum as a potential common vaccine candidate for the control of both neosporosis and toxoplasmosis. (2007 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cell surface during tachyzoite
  • "Immunofluorescence analysis showed that the NcP0 was localized to the surface of N. caninum tachyzoites"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AB284186, annotation matches
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10528

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_061830 60S acidic ribosomal protein P0
MAGSKGKSDKRKTYFSRLFALLEQYPRVLVVEADHVGSKQMADIRLALRGKAVVLMGKNTMIRTALKQKMSEMPQLEKLL
PLVRLNVGFIFCIEDPAEVRKIVSANKVPAPARQGVFAPIDVFIPAGPTGMDPGSTSFFQALGIATKIVKGQIEIQTEVH
LIKEGDKVTASAATLLQKLGIKPFEYGLAIQHVYDDGSVYKASVLDITDEVILDKFRTGTMNVAALSREIGMPTTASAPH
SILEAFKFCTSLVLESDYTFPQMQRLKDILENPDAFVVAAAAPAAGAAAVEAPKEEEPEEEEDDMGFSLFD

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_061830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins