ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_058810 (SOD)

superoxide dismutase, a gene from Neospora caninum

Compiled localisation
cell surface during tachyzoite

Who localised this protein by microscopy?

Cho, M. H., Na, B. K., Song, K. J., Cho, J. H., Kang, S. W., Lee, K. H., Song, C. Y., Kim, T. S.
Cloning, expression, and characterization of iron-containing superoxide dismutase from Neospora caninum. (2004 Apr, J Parasitol) PubMed / full text
   more detail about this publication

cell surface during tachyzoite
  • "In an immunofluorescence assay, the enzyme was localized on the cell surface of N. caninum tachyzoites"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AAL62028, annotation matches
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10139

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_058810 superoxide dismutase
MAFTLPPLPYAYDALAPHISADTLQFHHGKHHAGYVAKLNGFIEGTAFAGKTLEEVVRSSTGAIFNNAAQVWNHTFYFNS
MKPPTAGGGGKPTGRLLDEINKEFTSVEKFKEEFSKVAAGHFGSGWAWLVWDKQGKKVGIEQTHDACTPITEQMKVPLLC
CDVWEHAYYLDRKNDRPAYIKAWWEVVNWDFASKNLEEALK

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_058810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins