ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_054750 ()

hypothetical protein, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10262

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0142 serine/threonine protein phosphatase
  • PBANKA_102830 serine/threonine protein phosphatase, putative
  • PY07156 serine/threonine protein phosphatase alpha-3 isoform
  • PVX_085730 ser/thr protein phosphatase, putative
  • PCHAS_102910 serine/threonine protein phosphatase, putative
  • PKH_133280 serine/threonine protein phosphatase, putative
  • NCLIV_054750 hypothetical protein
  • cgd7_2670 serine/threonine protein phosphatase, putative
  • Chro.70303 hypothetical protein
  • CMU_034760 serine/threonine protein phosphatase, putative
  • TP02_0350 serine/threonine protein phosphatase, putative
  • TA12680 serine/threonine protein phosphatase 1, PP1-gamma catalytic subunit, putative
  • BBOV_III006130 Ser/Thr protein phosphatase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_054750 hypothetical protein
MASLDVDVDAVISKLLEVRGSRPGKPVQLTEAEIRGLCHKSREIFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGF
PPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPV
AAIIDEKIFCMHGGLSPELNSMDQIRRIVRPTDVPDTGLLCDLLWSDPEKEISGWGENDRGVSFTFGQDVVHNFLRKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKKKGMTK

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_054750

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins