ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_049080 ()

hypothetical protein, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10246

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_012310 vacuolar ATP synthase 16 kDa proteolipid subunit, putative
  • PCHAS_123460 vacuolar ATP synthetase, putative
  • PKH_101320 vacuolar ATP synthetase, putative
  • PFE0965c vacuolar ATP synthetase
  • Chro.10063 vacuolar ATP synthase 16 kDa proteolipid subunit (V-ATPase 16 kDa proteolipid subunit)
  • PVX_080285 vacuolar ATP synthetase, putative
  • PBANKA_123400 vacuolar ATP synthetase, putative
  • BBOV_II002740 proteolipid subunit c, putative
  • CMU_005350 vacuolar ATP synthase, C subunit, putative
  • CMU_005370 vacuolar ATP synthase subunit C, putative
  • cgd1_520 vacuolar ATP synthetase subunit
  • Chro.10062 vacuolar ATP synthetase
  • NCLIV_049080 hypothetical protein
  • PY06066 V-type ATPase, C subunit, putative
  • cgd1_540 vacuolar ATP synthase subunit, possible signal peptide
  • TGME49_023250 vacuolar type H+-ATPase proteolipid subunit, putative
  • TA07825 vacuolar H+-ATPase subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_049080 hypothetical protein
MFWSAFLQCDPNSTFFGFMGITAAMVFSNLGAAYGTAKSGVGISSMGVMRPDLVMRSIIPVVMAGILGIYGLIISIVING
SMDTPDTYSSYAGYGHLAAGLTVGLSAMAAGLAIGIVGDAGVRANAQQPKLFVGMMLILIFAEALGLYGLIIGLVVATKK
VEGLCTSYKA

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_049080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins