ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_043270 (MIC1)

microneme protein MIC1, putative, a gene from Neospora caninum

Compiled localisation
microneme during tachyzoite
during bradyzoite

Who localised this protein by microscopy?

Keller, N., Naguleswaran, A., Cannas, A., Vonlaufen, N., Bienz, M., Bjorkman, C., Bohne, W., Hemphill, A.
Identification of a Neospora caninum microneme protein (NcMIC1) which interacts with sulfated host cell surface glycosaminoglycans. (2002 Jun, Infect Immun) PubMed / full text
   more detail about this publication

microneme during tachyzoite, during bradyzoite
  • "Both intracellular parasites and tachyzoites which were in the process of liberating themselves from the host cells were stained exclusively at the apical tip."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Nc-1
  • Gene model mapping comments: blast from AF421187, incorrect gene model?
  • Localisation record: microneme during tachyzoite, reduced during bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115456

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_043270 microneme protein MIC1, putative
MGQSVVFVMLLSVIFTAGAKTYGEASQPSASARSLQGALDTWCQEVFKKLCDDGYSKMCIPANQVVARQGLGRKDQQKLV
WRCYDSAAFLAEGDENNVLSCVDDCGVSIPCPGGVDRDNSTHATRHDELSQLIKEGVVRYCSGFQAAANSYCNKRYPGTV
ARKSKGFGHKEPVKWRCYKPESLLFSVFSECVSNCGTTWSCPGGRLGTATNLDKKHFTDESGILQALTSVPKACPVGLVC
LPRDQNPPACLDDNGNVPEEEGGQPVQPRDTKLPVDDSEPTDESETTPGGGDDQPSPKEDGDTDSPDEGDQSGGSEWYKQ
IPEIRVIGDSLQAMLHAGQQLMVTYSSPQLHVSVGSCHKLTVNFSDYYLSFDTTSKSGSDEVELDDAAGSGELTIGLGSS
GRVTVVFQYATNGGGNRYVAYTVGDSGCKTIEAVLLHGLNPGAKLVRNTIGDNSPGESEL

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_043270

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins