ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_038110 (MIC17B)

hypothetical protein, a gene from Neospora caninum

Compiled localisation
apical during intracellular tachyzoite

Who localised this protein by microscopy?

Sohn, C. S., Cheng, T. T., Drummond, M. L., Peng, E. D., Vermont, S. J., Xia, D., Cheng, S. J., Wastling, J. M., Bradley, P. J.
Identification of novel proteins in Neospora caninum using an organelle purification and monoclonal antibody approach. (2011, PLoS One) PubMed / full text
   more detail about this publication

apical during intracellular tachyzoite
  • "In agreement with this, we isolated a large number of hybridomas that produced antibodies that stained an apical pattern consistent with the micronemes (Figure 6)."
  • Microscopy type: Fixed Light
  • Microscopy method: monoclonal antibody
  • Strain: NC1
  • Gene model mapping comments: taken directly from publication
  • Localisation record: apical during intracellular tachyzoite
  • Other genes localised in this publication: microneme protein 2, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26842

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_038110 hypothetical protein
MEALKTVLSRRIALPVVVAAVLLQDVTEAGQYAGLRSQLVNWHSFAETDSTNYSCMVQGKEYSGYVLAELSDVSDAASCQ
KNCDQHPQCRFFTFVSDKKRCRLQVRQPSEVRDNSNAFSGPKRCPVCVIEGYDFKGQPNINNNGVPGVTTLAACQVACQA
EPRCYGFLFNSNSKTCFFKKGKMYVSALVPDSKYIAGPKTCANERWCVMSGIQFNGGDKRTLKTKSAAACQDECLNDGDC
DYFSWIESSNECLLKAGSAVGAAKMTKSGVHSGPKHCGLPTTCIKEQTKYVDDTIATYPKTEVGSFAACQRRCWKTGNCF
FMHFNDEGCTLSGINATEVADANSKGGDVTC

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_038110

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins