ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_036410 (MAG1)

cyst matrix protein, putative, a gene from Neospora caninum

Compiled localisation
cytoplasm during bradyzoite and extracellular tachyzoite and intracellular tachyzoite
dense granule and parasitophorous vacuole lumen and parasitophorous vacuole during intracellular tachyzoite
cyst matrix and cyst wall during bradyzoite

Who localised this protein by microscopy?

Guionaud, C., Hemphill, A., Mevissen, M., Alaeddine, F.
Molecular characterization of Neospora caninum MAG1, a dense granule protein secreted into the parasitophorous vacuole, and associated with the cyst wall and the cyst matrix. (2010 Sep, Parasitology) PubMed / full text
   more detail about this publication

cytoplasm during bradyzoite and extracellular tachyzoite and intracellular tachyzoite, dense granule and parasitophorous vacuole and parasitophorous vacuole lumen during intracellular tachyzoite, cyst matrix and cyst wall during bradyzoite
  • "Immunofluorescence and TEM localized the protein mainly within the cyst wall and the cyst matrix. In both tachyzoites and bradyzoites, NcMAG1 was associated with the parasite dense granules. "
  • Microscopy type: Light
  • Microscopy method: antibody to whole protein
  • Strain: NC-Liverpool
  • Gene model mapping comments: blast from ABQ52425, annotation matches
  • Localisation record: punctuated cytoplasm during extracellular tachyzoite and bradyzoite, PV lumen during intracellular tachyzoite, cyst wall and cyst matrix during bradyzoite
  • Other genes localised in this publication: -
  • "minor labelling was observed in the intra-parasitic space, the lumen of the PV, and within the dense granule organelles of the tachyzoites (Fig. 5A)."
  • Microscopy type: EM
  • Microscopy method: antibody to whole protein
  • Strain: NC-Liverpool
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV and intraparasitic space and dense granule during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115231

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_036410 cyst matrix protein, putative
MAFGRGKRGLHAAVILGFFVLLATSSVGLGQRVPRYPSVESLEERVAEALGRRSSAAASTLPGSDTNMISDGRAGRDEPT
ASPEHHSVDAPTTSGEGEADAGKVTLRNDEGLEGNISADHVLHPPPDSEHEGLQEPGTTHQEAQEPDASEAMDSSALPLS
TSVPHPNEVGSTPGTALPAPIFSIPELSPEEVVYVLRVQGSGDFEISFQVGRVVRQLEAIKRAYREAHGKLEAEELESER
GPTVSTRTKLVDFIKENQRRLRAAFQKVKIQQKLEEIEELLQLSHALKSLGARLRPCQKSNSPMEEEICRKTKALGEMVA
QKAEDLRQHASTVSALLGREAVERQLRRVDSEQPYEQTDAGVAARAEEFRKALEKAASGARQFVGTTADEIVEEVKEDAQ
YLRDGAKEVLTKSQRALVDAFQAIQRALLEAKAKELVDAASKEAEDARKILAEQPA

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_036410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins