ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_036400 (GRA1)

dense granule protein 1 / major antigenp24, putative, a gene from Neospora caninum

Compiled localisation
cyst wall during bradyzoite
anterior cytoplasm and posterior cytoplasm during tachyzoite

Who localised this protein by microscopy?

Vonlaufen, N., Guetg, N., Naguleswaran, A., Muller, N., Bjorkman, C., Schares, G., von Blumroeder, D., Ellis, J., Hemphill, A.
In vitro induction of Neospora caninum bradyzoites in vero cells reveals differential antigen expression, localization, and host-cell recognition of tachyzoites and bradyzoites. (2004 Jan, Infect Immun) PubMed / full text
   more detail about this publication

cyst wall during bradyzoite, anterior cytoplasm and posterior cytoplasm during tachyzoite
  • "Granular-type immunolabeling was found predominantly within the parasite cytoplasm at the anterior and posterior ends of the tachyzoites. In contrast, bradyzoites exhibited staining for NcGRA1 (see Fig. 4D to F) and NcGRA7 (see Fig. 4J to L) that had largely shifted toward the periphery of the vacuole. For NcGRA2 (see Fig. 4G to I), peripheral labeling was not as pronounced but was clearly evident as well."
  • Microscopy type: light, EM
  • Microscopy method: polylonal antibody
  • Strain:
  • Gene model mapping comments: blast from AAK16239, annotation matches, incorrect gene model?
  • Localisation record: cyst wall during bradyzoite, posterior cytoplasm and anterior cytoplasm during tachyzoite
  • Other genes localised in this publication: 28 kDa antigen, putative, dense granule protein 7, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115230

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_036400 dense granule protein 1 / major antigenp24, putative
MVRVSAIVGVAASVVLSLSSGVYAAEGAEKPLGGEGQAPTLLSMLGGGRAGRGLSVGQSVDLDLMGRRYRVTRSEGAPDV
LEISVLDADGKASHIGFVSIPEVMDTVARMQKDEGIFLDALSKGETVKEAIEDVAAAEGLSPEQTENLEETVAAVATLVR
DEMEVLKDQEKLEEDAEKLAGDLEALQGQH

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_036400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins