ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_033690 (MIC2-like1)

hypothetical protein, a gene from Neospora caninum

Compiled localisation
apical and not nucleus during tachyzoite

Who localised this protein by microscopy?

Pereira, L. M., Candido-Silva, J. A., De Vries, E., Yatsuda, A. P.
A new thrombospondin-related anonymous protein homologue in Neospora caninum (NcMIC2-like1). (2011 Mar, Parasitology) PubMed / full text
   more detail about this publication

apical and not nucleus during tachyzoite
  • "NcMIC2-like1 was apically localized when compared to the nucleus (Fig. 5) and only diffuse fluorescence was detected when the serum was used on Vero cells as a control (data not shown), suggesting specific binding. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: Nc-1
  • Gene model mapping comments: blast from CF261023
  • Localisation record: apical and not nucleus during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20693

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0640w CSP and TRAP-related protein
  • PCHAS_041380 circumsporozoite- and TRAP-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_033690 hypothetical protein
MASHSSGTSQAFVRRSVFAVLLLSTLVSGVFAASGNVSGTSPGELVSLVQAASNEAGDQLQTCTKVMDLLLLVDDSASIG
SRNFEQVRKFVLDFIDLVPISSEEVHLSVVTFADSPQDVFTFKQPQATNKQLAKEAFKYLRYRRGGSTATDKGLIRARRY
LTRPVYGTRANVPKVLVLMTDGESDRHYDTIQAADQARAEGISVFVVGVGMANPVECRGVCGCGRYGPCPQFIMSNWNEL
VQTVDSIMGEVCKKLPKDAECSEWSEWSGCTASCGAGTRTKTRKQLSPPLAGDPPCDNCEPMMGKTCEDLGGLVRVEDCN
QGECPQDAGCGTWGEWTSWSATCGHASRSRKREGYNTPPPRGAGLLCEQKRPPVPREQSEETDFAPCPRNQVPGEWTDWS
VCSATCGGGTRHRSRSGSPQVGELYGGQTLQEQGIEVRQEEACSQNPCPVDAVCGEFGEWSECSRSCGGGVSVRKRDPWN
NDQQHGGKSCKQQFPEGREETKECNPEPCPVDEVPGDWIEWGPCSVTCGTGVMTRQRGPSRVEARFGGKTIAEQNARLSS
PILMQEEKECSPFPCGPCTYEFGPWGTCRGTCNDGFKIRHAAVRFDYTDAPCNLPTMEVDTCVPEGCSDAGTTVPGTGGE
PGGTGGESPNESTNNTGNSSGSTSGGAAEETTTTDEDKDEQGGIPTAAIAGGVVGGVLLLGAAAGGGYYMMGSAGASAAG
EAASADFLGDQQTAEVEAEDKEEMFGVDEDSEMWSA

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_033690

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins