ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_030050 (RON4)

hypothetical protein, conserved, a gene from Neospora caninum

Compiled localisation
apical during tachyzoite

Who localised this protein by microscopy?

Marugan-Hernandez, V., Alvarez-Garcia, G., Tomley, F., Hemphill, A., Regidor-Cerrillo, J., Ortega-Mora, L. M.
Identification of novel rhoptry proteins in Neospora caninum by LC/MS-MS analysis of subcellular fractions. (2011 May 1, J Proteomics) PubMed / full text
   more detail about this publication

apical during tachyzoite
  • "The anti-TgRON4 antibody was used to localize its orthologue in N. caninum, NcRON4. The protein was observed on the apical complex by immunofluorescence (Fig.ᅠ3A), where it was co-localized with NcROP2 (Fig.ᅠ3B)."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody to toxoplasma orthologue
  • Strain: Nc-Liv
  • Gene model mapping comments: taken directly from publication
  • Localisation record: apical complex during tachyzoite
  • Other genes localised in this publication: hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115012

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_030050 hypothetical protein, conserved
MAIMKSKFTGSGLLMLLTLAFGTTVQCNEPPSHPQLSQSTDTSATPTIYRSELETTLKVPGGAASQKPLASTGNVSISAE
STGTGSETPTSQAEGTSESLQERESQARPTPAPRRSEAQAQGQSPTTAPQSTVSTNTGESGNDGNDNETKGLYPSLDELK
ANGLYPSLDELKAKGLYPSLDELKENPNVTTPIRPSKGLYPSLDELKENPNVTTPIRPSKGLYPPLDEYRHYQEITWFSI
PVPMGVVDRRETRALKQQFTQFLQQLSANYPKLVQRVYEFLGWPSDKLPENEEQAQMFIDALNTSEALLGKAARWIFNAI
PEMERAAIYTSFYQLFRNKLPSSFFEAAGRVNPEVREYWNAEMPITGTWETPSEADKESEAGGETANSRKGQAHLTAQVL
QPLPVEGPTPRDRIPWMKIKSAISKAHGPVTRVPEWTPVTGACALGEGYTEIDVAKATTDVLFRLTFVILHQIKRKNSNN
GKLEDDQALVALCSTAGAFVDAWQQQQQALAQEDPGTPKAHAVLIERLRHVDKYFMKTYDETTGESDHKQWKKNKTEVAK
IGRVKAAGDVATRSFNAGTTKYPSRSLYGGIANTLETKFTDSEAVAKAVHDYARQHKMPEKLVGLCGALQISGHFKKCFS
EAGRLSSVTFFHQHIDGASVLLRTLARDRPIGKHAVAQAICDPSVSAQYFESAFRLFSSAVTQEWEKENLFAQLASWTGK
PVILAPSLEDQVPVPPAHAAYESVAVDDPDRIYRIRAGGRQSPPEVLYVGGLHPKVKPTEVHVQGPTVRDNSKRLVHDVH
PSEPRGEKAPSGTATTTESSSEDASSASSKSSSAFVDVQAQGKNNYEPGETVDSHLASPRKNEENSASAMPKRSTHSQGT
GRTRSVSAEL

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_030050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins