ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_028990 (56-kDa antigen)

hypothetical protein, a gene from Neospora caninum

Compiled localisation
apical during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Jenkins, M., Soares, R., Murphy, C., Hemphill, A., O'Handley, R., Dubey, J. P.
Localization of a 56-kDa antigen that is present in multiple developmental stages of Neospora caninum. (2004 Jun, J Parasitol) PubMed / full text
   more detail about this publication

apical during bradyzoite and tachyzoite
  • "Immunoelectron microscopy revealed the 56-kDa antigen to be present in the apical end of both tachyzoites and bradyzoites and possibly extracellularly secreted by tachyzoites."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AAR02100, annotation matches
  • Localisation record: apical during bradyzoite and tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10090

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_028990 hypothetical protein
MSPGRQFSSKTVPGPLSEGGSGVGTPGKAEGETELQHGGAGNGDGAEACTWQRPVRPIKKLLVANRGEIAVRVHRACKEL
GITSVGIYSQEDSQALHRQVFDESYLVGRGLSPVAAYLHYPDIIDVALRYNVDAIHPGYGFLSENAEFAAAVEDAGIMLV
GPPPEVIRLMGDKVEARSTAEKANVQAVPGTNEPVTNFDEAAEVCRQIGFPVMLKAAYGGGGRGMRRVFREDELKEAFER
ATSEAKAAFGNGAMFVEKLVQHGVHIEVQIMGDHYGHVVHLHERDCTVQRRHQKVIEVAPAPFLAPRVRERILADAVKLA
QSVNYQNAGTVEFLVEGDEHYFIEVNARLQVEHTVSEEITGVDLVKTQIAVRQGVSLPQLGISQDSINAAVRTDRITGHR
GPVALQCRITTEDSQRNFQPSTGRIDLYQPSTGPGIRLDGAIGASGAVITPFYDSLLVKLISKAHDFPEAVARATRALRE
TKIRGVTTNIPFILNVLQHPKFLSGAATTRFIDEQPDLLFYDPLDMSSQNICKYLATVIVNGPQTPLVNAEATPDKTSAT
PPPLPPSAVERVSIPAGAGSLAGAPDDLDLRIMNAASEGAPRGYKTLLDEVGPEGFARVIRTEKRVLLCDTTLRDGHQSL
LATRMRTIDMLKVAPAYAHLLPFLFSLENWGGATFDVAYRFLRESPWRRLELLREAIPNIPFQMLLRGANAVGYTAYPDN
AVEKFCREAVQYGMDVFRIFDSLNYVENLKLGIHAAGAAGGVVEAAIAYTGNVADPEKKPYTVDYYLDLASQLVATNCHI
LCVKDMAGLLTPPAAQLLIGALRREFPDIPIHVHTHDTGGCGVASLLAATEAGADIVDVAVDSLSGLTSQPCMGSLVSAL
KHTALDTEMDLQILSQFSDYFEQVRRFYAPFEATATVKNVSSEVHEHEIPGGQYTNLYMQAYALGMADRWREIKRAYCIA
NRLLGNPPKVTPSSKVVGDLAQFLVQNKLDEETVLARAEELSFPSSVIEYFQGHIGQPPFGFPEPLRTKALKGLPTVEGR
PGESLAPIDWTVVREQLESTHGRKFRDCDLVSSVLYPAVFDEYQQFLKNFGDVSMLPTAAYFTGLQPGESVTVHMAGREV
TVKYIAKTHVLPDGSRDVFFEVMGLPRVVNVIDLNASQDVVRNTKADPADPKQIASPMPGNVLQYKVKEGQVIRKNDPVV
IITAMKMETVVVSPVAGTVGDFLVREGDPVQQGDLLVRIL

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_028990

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins