ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_028680 (AMA1)

apical membrane antigen 1, putative, a gene from Neospora caninum

Compiled localisation
apical during tachyzoite

Who localised this protein by microscopy?

Zhang, H., Compaore, M. K., Lee, E. G., Liao, M., Zhang, G., Sugimoto, C., Fujisaki, K., Nishikawa, Y., Xuan, X.
Apical membrane antigen 1 is a cross-reactive antigen between Neospora caninum and Toxoplasma gondii, and the anti-NcAMA1 antibody inhibits host cell invasion by both parasites. (2007 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during tachyzoite
  • "The specific fluorescence was observed on the apical part of both intracellular and extracellular parasites"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from BAF45372, annotation matches, incorrect gene model?
  • Localisation record: apical during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114967

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_028680 apical membrane antigen 1, putative
MICSIMGSWRRERPARPSDQQWITEWRQIGIVGVAILLVLVAESSLLATGINPKTRSGGSQTLSASTPQNPFQTPELKAF
LERYNVTLHHQSGVNVDLGQDKEVDGKLYREAAGLCPVWGKYIQLHQPNRPPYKNNFLEDIPTEAEYQKSGNPLPGGFNM
NFVTPAGQRISPYPMELLEKSSKIKASTELGKCAEFAYKTTAMDKSNQATQYRYPFVYDSKRRLCYILSVSMQRMEGSKY
CSTNDDPVNLTWYCFEPQKSPTANHNLIFGSAYVGKDPDAFLTKCPNQALKGYRFGHWTNGRCHDYTELADSWIEAVDSK
AQCWVKTFTNDEVASDQPRTYPLTSQHSWNDWWPVHEKDQPHSGGDGRNYGFFYFDSNGKGKCALSHKAPDCLVSDSKAV
SYTALGSLSEETPDIIIPSNPSVNPSTPDEALQCRSSEFPETFGSCDVQACKRQKTSCVGGQIQSTSVDCTAEEQNDCGS
NTALIAGMAIGGVLIMGLLAGSGYYYSKRLNTNQGVPAVDHDHEFQTQRNAQKKRPSDLMQEAEPSFWDEAEENIDQSGE
TQVLVEGDY

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_028680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins