ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_027400 ()

hypothetical protein, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10710

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_010610 para-hydroxybenzoate--polyprenyltransferase,put at ive
  • PY01399 4-hydroxybenzoate octaprenyltransferase
  • PVX_113540 para-hydroxybenzoate--polyprenyltransf erase (4- hydroxybenzoate octaprenyltransferase), putative
  • PCHAS_010670 para-hydroxybenzoate--polyprenyltransferase,put at ive
  • PKH_114180 para-hydroxybenzoate--polyprenyltransferase,putative
  • TGME49_059130 4-hydroxybenzoate octaprenyltransferase, putative
  • NCLIV_027400 hypothetical protein
  • cgd3_2460 UbiA prenyltransferase family member (3I27) , putative
  • Chro.30285 UbiA prenyltransferase family member (3I27)
  • CMU_001010 4-hydroxybenzoate octaprenyltransferase, putative
  • TA18290 4-hydroxybenzoate octaprenyltransferase, putative
  • BBOV_III000400 prenyltransferase, UbiA family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_027400 hypothetical protein
MHAMKPTVSGSVLTLPRVRRELPGPTAPLRGASRHIKHSNCSNFITKGLRVPPVPSALLSVSSRAAKHSQDEDVSSWVLR
ETRVSAGWDALAHGRNPENGNAFSRLALSASCAFSPRSASLEAFSRVRNALSASSAAVSRPFSTASSPLLSLPGASVRRP
YAPRQKSVFPQPLPCVHLPIAVHTEAAKGFSGKAASQSLRVSHPSSSASRLSCASPATLASSHSQTGRSPFFLSPFSTAP
SSSPSPSSPSSPSPCPCPSSPSPSSPSSPSSPSSPSSPASTLAVSPSSSIADSPALRYPWVRRIVPDSVFPRVAAFLDLS
RFHAPIGSWLLFWPCAHSAALAAPASVLSPTYPQAAAAYIRAREDGTTLYQVLHAGAHPAADETAARTASEAAQTGQAAD
AVSAAALSVTEREGSSVARLLPGETNDQDLSEIANCLAALVPVEAVWLDTAKWIGLCGVGAVLMRSAGCIINDLLDRKLD
ARVERTQNRPLASGRLSPRAALASLSVHLGLSLGLLLLFNPPTVVTALCSVGLVAVYPLMKRVTHWPQLVLGLTFNWGSL
VGWTAVMGRFLLPESASLPAPDAAPSLAALSAGTAEPVKPATPWIASGAGSLGVAFASGLDSTLFPLGLTPFLLYFSGIF
WTLTYDTIYAHQDKKDDRRVGIKSTALLLGTRTPLWTAVFSSVYATGLVGAGLCTQASWPFFASVALCYAQLLQQSRTNL
DDPKACGAAFKRNHWVGLTLFCGILASKWTEASRENSAEAGQARGDAASAGAA

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_027400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins