ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_022970 (MIC2)

microneme protein 2, putative, a gene from Neospora caninum

Compiled localisation
microneme during intracellular tachyzoite

Who localised this protein by microscopy?

Sohn, C. S., Cheng, T. T., Drummond, M. L., Peng, E. D., Vermont, S. J., Xia, D., Cheng, S. J., Wastling, J. M., Bradley, P. J.
Identification of novel proteins in Neospora caninum using an organelle purification and monoclonal antibody approach. (2011, PLoS One) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "Phase contrast and IFA showing eleven mAbs that stain the apical micronemes of Neospora. Colocalization is demonstrated using antibodies against Neospora MIC2."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: NC1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein

Lovett, J. L., Howe, D. K., Sibley, L. D.
Molecular characterization of a thrombospondin-related anonymous protein homologue in Neospora caninum. (2000 Mar 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme
  • "predicted amino acid sequence of NcMIC2 contains one integrin-like domain (I or A domain), five thrombospondin (TSP) repeats, a putative transmembrane spanning region and intracellular C-terminus, and was localized to micronemes by cryo-immunoelectron microscopy"
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AAF01565, annotation matches, incorrect gene model?
  • Localisation record: microneme
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20693

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0640w CSP and TRAP-related protein
  • PCHAS_041380 circumsporozoite- and TRAP-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_022970 microneme protein 2, putative
MGVQREAFFGLMFAFGLCLFPREVAGGRWGLMDIFKREPKATATASDGEDTEGSAITDLMKSGGTIGAAEGCTSQLDICF
LVDSSGSIGEAHYEEVKQFLHAFLSKLPIGNDEVNTSLVIFSTTVHPHWSLRANNASDKETAMQDVLTIPYHGGTTNTAA
GLQTCNQMLFDYPREERQTVPKLVIAMTDGESDSDFHTVNEAKVIRERGGIITVLSVGMYVNHNECRSMCGCRNDSSPCP
LYLQTEWSQLLPSISPILKEVCKTLPKDAVCSEWSEWSPCSATCGVGTQGRTRQQLSPPAPGTPTCPDCIPPMGRSCEEQ
GGVKENRSCDAGTCSVDAGCGTWGLWSEWSSSCGAATRQRVREGYNQPPPQGDGLLCEQQQPPVERSQTEQAQFAPCVVI
PPTPPEWSAWSECTATCGGGTRHRSRNGLPPGTRSADQNTEQKPESNPWPGFDLHEQESCNNSPCPINATCGDFGEWSEC
SVSCGGGLSQRSRDPWNNDQQHGGKSCMQQYPNGHTEKRSCNAQPCPVDEEPGDWEEWGECNVTCGQGERTRRRGRSVIL
PQYGGRSIVEQNKSLPENEKILLVETETCSLPPCDASCTFPWSDWSSCEQCEAGTGTQYRNSAVKFDYRNKPCDLPTFQT
QSCDCGETVPVPAPPPSEQVTPSAPYDVPERHEEREKNAGDEEPKSESEGVPVAAIAGGIVGGLILLGAAGGGAYYYFGG
GKANESLAEMDFDVDSGATKVVMEEEKETLVPVDDDSDMWMGADH

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_022970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins