ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_017370 ()

CAMP-dependent protein kinase regulatory subunit, putative, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10443

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL1110c cAMP-dependent protein kinase regulatory subunit
  • PBANKA_143800 CAMP-dependent protein kinase regulatory subunit, putative
  • PY03451 putative cAMP-dependent protein kinase regulatory subunit
  • PVX_123785 cAMP-dependent protein kinase regulatory subunit, putative
  • PCHAS_144000 CAMP-dependent protein kinase regulatory subunit, putative
  • PKH_143960 CAMP-dependent protein kinase regulatory subunit, putative
  • TGME49_042070 cAMP-dependent protein kinase regulatory subunit, putative
  • TGME49_111300 cAMP-dependent protein kinase regulatory subunit, putative
  • NCLIV_017370 CAMP-dependent protein kinase regulatory subunit, putative
  • NCLIV_055220 CAMP-dependent protein kinase regulatory subunit, putative
  • cgd7_120 cAMP-dependent protein kinase regulatory subunit
  • Chro.70024 cAMP-dependent protein kinase regulatory subunit
  • CMU_006780 cAMP-dependent protein kinase regulatory subunit, putative
  • TP02_0494 cAMP-dependent protein kinase regulatory subunit, putative
  • TA13500 cAMP-dependent protein kinase regulatory subunit, putative
  • BBOV_II005430 cAMP-dependent protein kinase regulatory subunit , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_017370 CAMP-dependent protein kinase regulatory subunit, putative
MGNACECQKADTVQEESPAAPVLTKVTKGKGTTGSSSSGQKTSGTKAASSNSSTVVPQLTEDDLDTEDEKDDDVVEDMPQ
PSEAYMSRAKNRQSVSAEAYGEWNKRKKFVAPVYPKTAEQKERITKVIESSFLFSSLDIEDLEIVINAFQEVSVKKGTVI
IRQGDDGDRLYLIETGEVDVMKKFPGEKENKFLCKMRPGDAFGELALMYNAPRAATVIAADDMLLWALDRDSFTNIVRDA
AAKKREVFEESLKEVRILEDMDPYERSKLSDALRTATYEDGDVIIKEGETGDTFYILLEGTAEAIKNDKVVMEYKKGGFF
GELALLKDQPRAATVVAKSHVQVAYMDRKSFKRLLGPVEQILMRNQDNYRKAMEQLGLDTKYLDK

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_017370

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins