ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_014450 ()

Phosphoglucomutase 2, related, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10663

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_014450 Phosphoglucomutase 2, related
  • cgd2_3260 phosphoglucomutase, tandemly duplicated gene
  • cgd2_3270 phosphoglucomutase, tandemly duplicated gene
  • Chro.20343 hypothetical protein
  • CMU_003300 phophoglucomutase-1 protein, putative
  • CMU_003310 phosphoglucomutase/phosphomannomutase, C-terminal domain-containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_014450 Phosphoglucomutase 2, related
MFVCRLCRSISTIAAELPVADGTPLRVAKKLFLTSCLLKTFRCNHGGGAKSAAVLCRASVRTPHLLPLVALRASFLSSFG
SIVTTAKASRMRAKKEGCSGSASQSHKGLSSDRILSRPTTAYQDQKPGTSGLRKKTKVFMQKDYLANFAQSVFDCLPEEE
KKGGTLLVSGDGRYFSHEAIYEICAIAAGNGVGRVWIGLNGLASTPACSAIIRGRENGVCFGGFLLTASHNPGGIDEDFG
VKYDTGNGAPGNEVLMNQVWEKSKKLATIKYAELPKFSLDKLGVQVNLDGAFQVEVIDPIEDWMHLMKEAFHFPAIRRLL
ALPYFSFVYDAMHGVSGPYAEKLFLEELGAKPESLMRQVPLPDFGGHHPDPNLTYAAELVAKMKVFHPDQIDASTPLFGA
AGDGDCDRNMILGRGFFVTPSDSVALIALYAEKCLPFFFVDKATGKGGLTGLARSMPTSRALDNVAKKLNKDVYETPTGW
KYFTNLMDANRISICGEESFGTGSVHVREKDGLWAILCWLSILAYRNGCMADVERERAAAKADKPVDVSPPATKEDFVSV
QRIVEEFWKEYGRNFYCRYDFENKDSTAAHQMMHDLEELSKSSPTEIVAKVASHVDEKLLKEMEIESMDWFKYTDPVDQQ
VSDHQGVRLFLKGGSRIIWRLSGTGSTGATIRVYMERYESDSSKVLQDERTALKDIATFALQFCDMKKYIGTEEPTVIT

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_014450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins