ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_011410 (PDI)

protein disulfide isomerase, a gene from Neospora caninum

Compiled localisation
during not bradyzoite
area around nucleus and cell surface during tachyzoite

Who localised this protein by microscopy?

Naguleswaran, A., Alaeddine, F., Guionaud, C., Vonlaufen, N., Sonda, S., Jenoe, P., Mevissen, M., Hemphill, A.
Neospora caninum protein disulfide isomerase is involved in tachyzoite-host cell interaction. (2005 Nov, Int J Parasitol) PubMed / full text
   more detail about this publication

during not bradyzoite, area around nucleus and cell surface during tachyzoite
  • "immunogold-EM on tachyzoites localised the protein to the cytoplasm, mostly in close vicinity to the nuclear membrane, to the micronemes, and to the parasite cell surface."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AY751081, annotation matches
  • Localisation record: not during bradyzoite, cytoplasm mostly near nuclear membrane and cell surface during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10306

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_011410 protein disulfide isomerase
MRAGFSFVLLAVGLLATASVYCAAEEEAVTVLTASNFDDTLKNTEIVLVKFYAPWCGHCKRMAPEYEKAAKILKEKGSKI
MLAKVDATSETDIADKQGVREYPTLTLFRNQKPEKFTGGRTAEAIVEWIEKMTGPAVTEVEGKPEEQVTKESPIAFVAEL
SSKDSDMAKLFEDVANESRQLGKFLAKYGVSDEKIYSLRYEEGTEPFTGKTKDELKKFVDTESFPLLGPINAENFRKYID
RDLDLVWLCGTEKDFDEAKAAVREAAKKLRDTRSFVWLDTDQFKGHAENALGITEFPGLVFQSKKGRFVLPEATSSLKDA
AKISKFFEDVDAGKIERSLKSEPVPEKQDEAVKVVVGKNFEEMVIQKDKDVMLEIYAPWCGYCKSFEPIYKEFAEKYKDV
DHLVVAKMDGTANEAPLEEFSWSSFPSIFFVKAGEKTPMKFEGSRTVEGLTEFINKHGSKPLKKDDKGEEL

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_011410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins