ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_006210 ()

hypothetical protein, a gene from Neospora caninum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11931

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>NCLIV_006210 hypothetical protein
MASPTPTEPEPSDMSAALDSVSMEEDFQHSPRFVEARDGPSSSAPPAFLVHHLHTPLAASLARRQVADPQSSRKKMPKSR
DSSTGPPRVAHSGNGNPTCKGSAAATSAVPPLSRSLSGTKIMSPTSVDTNSTQSRSSGSGLAPRKLASTAGGGCRTNVKV
VVRCRPMTAAEQRDSHNVVDVCTERNEVIVRLRGGGPAGLGKPLQNAGGPAGGSGTASRTQNATGGSNSSKIFRFDGVCP
VSTSQKQFFEQHAQPLVDEVLQGFNCTIFAYGQTGTGKTFTVEGAPRGGDSLYSADDDIVENADCGLIGRSVQRIFSTLR
GERAAKDYTVTCSFLEIYNEELIDLFSPPGSAGGCPSSQSSLCGTDLNDSQASQSSLPTPRLRIYEDQSNSPAFDSPAAG
SGGAAPAGSSRAPQQGRGVVRVEGLEEKEVKSERDVFALLRAAAPRRSFAASSANAHSSRSHTIFSISVCIRDTASALAV
EEAGELASLKGRRKGAPSGFAPTAAGAPVEEEVVRVGKLNLVDLAGSENIYKSWGATAEEKRRREALTINKSLLTLGRCI
NALVDGASYVPYRDSKLTRLLQDSLGGCTKTCLIATISPAENVVEETVNTLDYAYRAKSIQNLPVKTLRHSKSLLLSSLL
HENQQLKLLLSSQRERDGVFLPLPLYTQHEQQMRSQQEQLERQENQIRRLEECVQQQEAELKSFAEVKSRLQIALEERES
VEQKAAELAARLDAAGAKTRDLEAQLRRREAEETFLLEQLTQELQREHEAAASARCTLEQAVQELVSVASHQKATLVRSR
ERARETSVCFAQVVDAACTELGHEQSRMHSRLEASLKALSAQEDVRAAAAAKTAALLQDHLEAQRKQEEQEHERRGERLE
RWRHQAEVHCGQATEGIERLELEFQRLREKGKGLLGESGRRARATLEHIHSQVRKGVETSATLLEEKAGDEAKQREQAQL
LVTALVEKEALHTSSTAEALDRLARELGLWKETQERHLVDATAQLVSTVQRQMQLLATHHQDGLERHVQSLQRQLKMLRD
EQTAQGNTVKAMGGELAAASDGGGAAVSALASAARTGFDSLLATLNQAAEEGCEAAKAQETAAAAAFEDDAQSSQTHFAA
LKDRISAHREGFRASLEQAAECERKSAVARAEAAQAACEASCERQAEEERLRGVARGLLGDIREVAQVAETHRREALTKQ
QQRAGEFAKAIRRELPAPCAGQCPVSPDQPVSLAETAGGRPSPCHFCAVEASMGKWTNRAEVSAASSKSLIDGDGDFSRL
PDLLRRRFHDLEQGSKGSESHPEARESSALASESATASSSLSPLTTGCSDSDAGTSSPEVAFTEKSSGLLHLNLGVSSDF
GGAPSTTASPGVPSEASRSTACALSVRVSPADTVGVDGGDSAGEEEGRALIAAGEQACGEGDLALSGPSDDNLEEATEDE
AENSRPSQPRPAPSKGDKSARRTQGDPRRRPTVPLRHGKGLVMQRPVASVPCSGSGASCRPSPGVGKSTEGLRKGPSAVV
RKGDVDTAKPHVVSRGVVHRQHDHLSPLKNAMKGTVAATSASACPIKAVPKTQSAVENFPDLPAATEDARRGGAGNGEVD
KRARAAVLLPSETAKSRSGNASRDEDERQRHGLRRRRSSDGLFLGLESEKKKPNTDAVSPYSELSKIFQAAAAPRAATGE
DSGSLKRRPTVPANRLFKALLRSGLLDRDLGGVAQKDSKTAPAIEFGQLCEFYEQGRFYDTWGGGAQILKISGVRGLAPP
GGNLKGGIIDSTPKCMNYEEFRTFVQAVRVWLRDKHSPVPLSGATMKATGSSTTPGRVVD

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_006210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins