ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

NCLIV_000610 (Profilin)

profilin family protein, putative, a gene from Neospora caninum

Compiled localisation
apical during tachyzoite

Who localised this protein by microscopy?

Jenkins, M. C., Tuo, W., Feng, X., Cao, L., Murphy, C., Fetterer, R.
Neospora caninum: cloning and expression of a gene coding for cytokine-inducing profilin. (2010 Aug, Exp Parasitol) PubMed / full text
   more detail about this publication

apical during tachyzoite
  • "Immunofluorescence and immunoelectron microscopy localized native NcProfilin to the apical end of N. caninum tachyzoites."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NC-1
  • Gene model mapping comments: blast from protein sequence MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKEDHEEDTIGEDGNVNGKVTVNEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY, annotation matches
  • Localisation record: apical during tachyzoite
  • Comment: genbank cited in paper not found at NCBI. Not yet uploaded?
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23358

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>NCLIV_000610 profilin family protein, putative
MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKEDHEEDTIGEDGNVNGKVTVNEASTIKAAVDDG
SAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQ
SGY

Proteomics

Found in:

Not found in:

Gene-Specific Links for NCLIV_000610

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins