ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

Z71755 (MIC2)

gi|209414697|emb|Z71755.2| Eimeria tenella mRNA for acidic microneme protein precursor, clone Etmic-2, a gene from Eimeria tenella

Compiled localisation
apical and not sporozoite surface during sporozoite
sporozoite surface during sporozoite invasion
host cell surface during after sporozoite invasion of enteric cells and sporozoite invasion
microneme during merozoite

Who localised this protein by microscopy?

Ferguson, D. J., Campbell, S. A., Henriquez, F. L., Phan, L., Mui, E., Richards, T. A., Muench, S. P., Allary, M., Lu, J. Z., Prigge, S. T., Tomley, F., Shirley, M. W., Rice, D. W., McLeod, R., Roberts, C. W.
Enzymes of type II fatty acid synthesis and apicoplast differentiation and division in Eimeria tenella. (2007 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during merozoite

Labbe, M., de Venevelles, P., Girard-Misguich, F., Bourdieu, C., Guillaume, A., Pery, P.
Eimeria tenella microneme protein EtMIC3: identification, localisation and role in host cell infection. (2005 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme

Bumstead, J., Tomley, F.
Induction of secretion and surface capping of microneme proteins in Eimeria tenella. (2000 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and not sporozoite surface during sporozoite, sporozoite surface during sporozoite invasion, host cell surface during after sporozoite invasion of enteric cells and sporozoite invasion
  • "Extensive ムtrailsメ of microneme protein antigens were seen on the monolayer, apparently released from the posterior end of gliding sporozoites. The trails were mainly serpentine in pattern (Fig. 2a) and they often led to a sporozoite, or a sporozoite-infected cell. In some cases, the trail finished abruptly just before the point of parasite invasion ( Fig. 2b) and some newly infected cells could be seen to have EtMIC2 dispersed all over their surface ( Fig. 2c). Similar patterns of staining were seen with antibodies against EtMIC1, EtMIC5 and whole micronemes (data not shown)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Wis
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical and not sporozoite surface during sporozoite, sporozoite surface during sporozoite invasion, host cell surface during sporozoite invasion and after sporozoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>Z71755 gi|209414697|emb|Z71755.2| Eimeria tenella mRNA for acidic microneme protein precursor, clone Etmic-2
MARALSLVALGLLFSLPPSSAVRTRVPGEDSFSPESGVLSGTDAPERRPIVPGLDEGNCGRLTVRNGLSVDETIKVTSAG
WTKSERDFIVSLVADETRKVVQLRESEGASGASGPGPAPAEKPPSGQGSAEEAPKGEGGQEKPSVPLIAVRIHGSGGDKG
ESAPQSAVLLYGNDESEPTEVPLETAAGPTTPLMVLITQQNPKEVEVRVLAWISTDATTGKGSWKENSVVVGSSLSGRDL
TVNLSDCGPSSLRVYGSASADLVTVKEGMCEADDPELIALTRPHTSAASPLPAEEGDVAQDAQQSAGAQQEAEAQEVGEP
QQEAAAAEQGSSAAESDTQQSS

Proteomics

Found in:

Not found in:

Gene-Specific Links for Z71755

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins