ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

EU093966 (MIC1)

gi|156257451|gb|EU093966.1| Eimeria tenella microneme 1 precursor, mRNA, partial cds, a gene from Eimeria tenella

Compiled localisation
apical and not surface during sporozoite

Who localised this protein by microscopy?

Tomley, F. M., Billington, K. J., Bumstead, J. M., Clark, J. D., Monaghan, P.
EtMIC4: a microneme protein from Eimeria tenella that contains tandem arrays of epidermal growth factor-like repeats and thrombospondin type-I repeats. (2001 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

apical and not surface during sporozoite
  • "We examined the surface localisation and secretion of EtMIC4, together with that of EtMIC1, another sporozoite microneme protein which contains TSP-1-like repeats and has the same conserved TM-CT sequence as EtMIC4. In methanol-permeabilised, freshly-hatched sporozoites ( Fig. 5), it can be seen that both EtMIC1 and EtMIC4 are localised predominantly within the apical tip of the parasite. However, in paraformaldehyde-fixed, non-permeabilised sporozoites, EtMIC4 is readily detected on the surface, whereas EtMIC1 staining is absent."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: Wis
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical and not surface during sporozoite
  • Other genes localised in this publication: gi|187340650|emb|AJ306453.2| Eimeria tenella mRNA for microneme protein 4 (mic4 gene)

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>EU093966 gi|156257451|gb|EU093966.1| Eimeria tenella microneme 1 precursor, mRNA, partial cds
TSSGQDQVCTSLLDVMLVVDESGSIGTSNFRKVRQFIEDFVNSMPISPEDVRVGLITFATRSKVRWNLSDPKATNPSLAI
SAARSLSYSTGVTYTHYGLQDAKKLLYDTNAGARNNVPKLVLVMTDGASNLPSQTRSSAAALRDAGAIVVVLGVGSGVNS
SECRSIAGCSTSNCPRYLQSNWSNVTQQVNGIIKAACKDLAKDAVCSEWSEYGPCVGECGKEGVQTSTRVEISPQKPGSP
PCPTCEAPRCRSCAEQPPGLTRTQPCTMPVCKTDAHCGEFGAWSEWSTTCGTATRKRQREGYNSPPAAGGGLSCMEQNPP
KHEFEVETVQKSPCPVQQQPGPWSEWTECSATCGGGTKHREREGLPQEGELYGGQTLEQQGIAVRETASCSENPCPIDAT
CGEWTEYSACSRTCGGGTQERKREPWLDNAQHGGRTCMEQYPDGPISVRECNTQPCPVDEVVGDWEDWGQCSEQCGGGKR
TRNRGPSKQEAMFGGKTVAQQNAELPEGEKIEVVQEEGCNEVPCGPCTLPFSEWTECESCSGHRTRESAVAFDYTDRMCS
GDTHEVQSCEEYCSQNAGGGAGGDGGAGGGTGGSGEEEGKEESSGFPTAAVAGGVAGGVLAIAAGAGAFYGLSGGSAAAA
TEAGAEVMTEAGTSNAAEVEKESLISAGEQSEMWA

Proteomics

Found in:

Not found in:

Gene-Specific Links for EU093966

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins